| Clone Name | bastl44g09 |
|---|---|
| Clone Library Name | barley_pub |
>AMPE_HUMAN (Q07075) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP)| (Aminopeptidase A) (APA) (Differentiation antigen gp160) (CD249 antigen) Length = 957 Score = 37.7 bits (86), Expect = 0.008 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +1 Query: 37 PSTPPLQ---ICPPTMAESPEQFRGQSRLPRFAEPLRYDLVLRPDLAACTFSGSAS 195 PS PP Q ICP + ES + RLP F P+ YDL ++P L T++G+ S Sbjct: 67 PSGPPAQDQDICPASEDESGQW--KNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS 120
>AMPE_PIG (Q95334) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP)| (Aminopeptidase A) (APA) Length = 942 Score = 35.4 bits (80), Expect = 0.041 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +1 Query: 25 NLPRPSTPPLQ--ICPPTMAESPEQFRGQSRLPRFAEPLRYDLVLRPDLAACTFSGSAS 195 +LP S+PP +CP + ES RLP F P+ YDL ++P L T++G+ + Sbjct: 54 HLPPTSSPPQDQGVCPASEDESGNW--RDFRLPDFINPVHYDLQVKPLLEQDTYTGTVN 110
>PSA_MOUSE (Q11011) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA)| Length = 920 Score = 34.7 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +1 Query: 73 MAESPEQFRGQSRLPRFAEPLRYDLVLRPDLAACTFSGSASAA 201 +A PE+ R RLP P+ Y L L+PDL TF G AA Sbjct: 43 LAAMPEK-RPFERLPAEVSPINYSLCLKPDLLDFTFEGKLEAA 84
>LCAP_HUMAN (Q9UIQ6) Leucyl-cystinyl aminopeptidase (EC 3.4.11.3) (Cystinyl| aminopeptidase) (Oxytocinase) (OTase) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Placental leucine aminopeptidase) (P-LAP) Length = 1025 Score = 34.7 bits (78), Expect = 0.070 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +1 Query: 103 QSRLPRFAEPLRYDLVLRPDLAACTFSGSAS 195 Q RLP PLRY+L L P+L + TF GS + Sbjct: 165 QIRLPTAVVPLRYELSLHPNLTSMTFRGSVT 195
>PSA_HUMAN (P55786) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA)| Length = 919 Score = 34.7 bits (78), Expect = 0.070 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +1 Query: 73 MAESPEQFRGQSRLPRFAEPLRYDLVLRPDLAACTFSGSASAA 201 +A PE+ R RLP P+ Y L L+PDL TF G AA Sbjct: 42 LAAMPEK-RPFERLPADVSPINYSLCLKPDLLDFTFEGKLEAA 83
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 32.3 bits (72), Expect = 0.35 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 82 SPEQFRGQSRLPRFAEPLRYDLVLRPDLAACTFSG 186 S E + ++ LP+ +P+ YDL L PDL T+ G Sbjct: 10 SKEDDKNRNLLPKNVKPIHYDLSLYPDLETFTYGG 44
>AMPE_MOUSE (P16406) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP)| (Aminopeptidase A) (APA) (BP-1/6C3 antigen) Length = 945 Score = 32.0 bits (71), Expect = 0.45 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 11/69 (15%) Frame = +1 Query: 13 CVQKNLPRPSTPPLQ-----------ICPPTMAESPEQFRGQSRLPRFAEPLRYDLVLRP 159 C Q P PS PP + +CP + ES E RLP F P+ YDL ++ Sbjct: 43 CEQDTTPAPSQPPPEASTALPPQDQNVCPDSEDESGEW--KNFRLPDFINPVHYDLEVKA 100 Query: 160 DLAACTFSG 186 + ++G Sbjct: 101 LMEEDRYTG 109
>LCAP_RAT (P97629) Leucyl-cystinyl aminopeptidase (EC 3.4.11.3) (Cystinyl| aminopeptidase) (Oxytocinase) (OTase) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Placental leucine aminopeptidase) (P-LAP) (Vesicle prot Length = 1025 Score = 31.6 bits (70), Expect = 0.59 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 103 QSRLPRFAEPLRYDLVLRPDLAACTFSGSAS 195 Q RLP P RY+L L P+L + TF GS + Sbjct: 165 QIRLPTAIIPQRYELSLHPNLTSMTFRGSVT 195
>ARTS1_RAT (Q9JJ22) Adipocyte-derived leucine aminopeptidase precursor (EC| 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) Length = 930 Score = 30.8 bits (68), Expect = 1.0 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Frame = +1 Query: 61 CPPTMAESPEQFRGQS------RLPRFAEPLRYDLVLRPDLAACTFSG 186 C + SP+ G S RLP + P+ YDL++ +L+ TF G Sbjct: 20 CQNSDTASPKASNGASFPWNNMRLPEYITPIHYDLMIHANLSTLTFWG 67
>AAP1_YEAST (P37898) Alanine/arginine aminopeptidase (EC 3.4.11.-)| Length = 856 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 112 LPRFAEPLRYDLVLRPDLAACTFSGS 189 LP PL YD+ L P+ A TF GS Sbjct: 6 LPNNVTPLHYDITLEPNFRAFTFEGS 31
>CLD12_PONPY (Q5R9K1) Claudin-12| Length = 244 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 10 YCVQKNLPRPSTPPLQICPPTMAESPEQFRGQSRL 114 YC K+LP P PL PP+M + + +SRL Sbjct: 196 YCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRL 230
>CLD12_HUMAN (P56749) Claudin-12| Length = 244 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 10 YCVQKNLPRPSTPPLQICPPTMAESPEQFRGQSRL 114 YC K+LP P PL PP+M + + +SRL Sbjct: 196 YCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRL 230
>AMPE_RAT (P50123) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP)| (Aminopeptidase A) (APA) Length = 945 Score = 30.0 bits (66), Expect = 1.7 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 11/72 (15%) Frame = +1 Query: 13 CVQKNLPRPSTPP-----------LQICPPTMAESPEQFRGQSRLPRFAEPLRYDLVLRP 159 C P PS PP +CP + ES E RLP F +P+ YDL ++ Sbjct: 43 CEPGTTPAPSNPPPHTSTALPPQDQNVCPDSDDESGEW--KNFRLPDFIQPVHYDLEVKV 100 Query: 160 DLAACTFSGSAS 195 + ++G S Sbjct: 101 LMEEDRYTGIVS 112
>RNPS1_XENLA (Q5XG24) RNA-binding protein with serine-rich domain 1| Length = 283 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 28 LPRPSTPPLQICPPT--MAESPEQFRGQSRLPRFAEPLR 138 +PR +PP ++ PP SP + R +SR PR P+R Sbjct: 224 MPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVR 262
>RUM1_SCHPO (P40380) Protein rum1 (p25-rum1)| Length = 230 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 37 PSTPPLQ-ICPPTMAESPEQFRG 102 PSTPP++ +C P+ ESP F+G Sbjct: 3 PSTPPMRGLCTPSTPESPGSFKG 25
>ARTS1_MOUSE (Q9EQH2) Adipocyte-derived leucine aminopeptidase precursor (EC| 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (VEGF-induced aminopeptidase) Length = 930 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 109 RLPRFAEPLRYDLVLRPDLAACTFSG 186 RLP + P+ YDL++ +L+ TF G Sbjct: 42 RLPEYMTPIHYDLMIHANLSTLTFWG 67
>RNPS1_RAT (Q6AYK1) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 31 PRPSTPPLQICPPT--MAESPEQFRGQSRLPRFAEPLR 138 PR +PP ++ PP SP + R +SR PR P+R Sbjct: 247 PRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVR 284
>RNPS1_PONPY (Q5NVM8) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 31 PRPSTPPLQICPPT--MAESPEQFRGQSRLPRFAEPLR 138 PR +PP ++ PP SP + R +SR PR P+R Sbjct: 247 PRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVR 284
>RNPS1_MOUSE (Q99M28) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 31 PRPSTPPLQICPPT--MAESPEQFRGQSRLPRFAEPLR 138 PR +PP ++ PP SP + R +SR PR P+R Sbjct: 247 PRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVR 284
>RNPS1_MACFA (Q4R5N1) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 31 PRPSTPPLQICPPT--MAESPEQFRGQSRLPRFAEPLR 138 PR +PP ++ PP SP + R +SR PR P+R Sbjct: 247 PRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVR 284
>RNPS1_HUMAN (Q15287) RNA-binding protein with serine-rich domain 1 (SR-related| protein LDC2) Length = 305 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 31 PRPSTPPLQICPPT--MAESPEQFRGQSRLPRFAEPLR 138 PR +PP ++ PP SP + R +SR PR P+R Sbjct: 247 PRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVR 284
>GC3_MOUSE (P22436) Ig gamma-3 chain C region, secreted form| Length = 329 Score = 28.5 bits (62), Expect = 5.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 16 VQKNLPRPSTPPLQICPP 69 ++ +P+PSTPP CPP Sbjct: 96 IEPRIPKPSTPPGSSCPP 113
>GC3M_MOUSE (P03987) Ig gamma-3 chain C region, membrane-bound form| Length = 398 Score = 28.5 bits (62), Expect = 5.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 16 VQKNLPRPSTPPLQICPP 69 ++ +P+PSTPP CPP Sbjct: 96 IEPRIPKPSTPPGSSCPP 113
>ARTS1_HUMAN (Q9NZ08) Adipocyte-derived leucine aminopeptidase precursor (EC| 3.4.11.-) (A-LAP) (ARTS-1) (Aminopeptidase PILS) (Puromycin-insensitive leucyl-specific aminopeptidase) (PILS-AP) (Type 1 tumor necrosis factor receptor shedding aminopeptidase r Length = 929 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 109 RLPRFAEPLRYDLVLRPDLAACTFSGS 189 RLP + P+ YDL++ +L TF G+ Sbjct: 41 RLPEYVIPVHYDLLIHANLTTLTFWGT 67
>TRHDE_MOUSE (Q8K093) Thyrotropin-releasing hormone degrading ectoenzyme (EC| 3.4.19.6) (TRH-degrading ectoenzyme) (TRH-DE) (TRH-specific aminopeptidase) (Thyroliberinase) (Pyroglutamyl-peptidase II) (PAP-II) Length = 1025 Score = 28.5 bits (62), Expect = 5.0 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 37 PSTPPLQICPPTMAESPEQFRG--QSRLPRFAEPLRYDLVLRPDLAACTFSGSAS 195 P TP Q P E EQ++ Q RL +PL Y+L+L + TFSG + Sbjct: 118 PGTPSAQ---PPSEEEREQWQPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVN 169
>R3HD1_HUMAN (Q15032) R3H domain-containing protein 1| Length = 1099 Score = 28.1 bits (61), Expect = 6.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 34 RPSTPPLQICPPTMAESPEQFRGQSRLPRFAEPLRYD 144 RPS PPL I P + +G SR P +PL+Y+ Sbjct: 905 RPSGPPLSIM-PQFSRPFVPGQGDSRYPLLGQPLQYN 940
>AMPN_RABIT (P15541) Aminopeptidase N (EC 3.4.11.2) (rbAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 965 Score = 27.7 bits (60), Expect = 8.6 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = +1 Query: 10 YCVQKNLPRPSTPPLQICPPTMAESPEQFRGQS------RLPRFAEPLRYDLVLRPDLA 168 Y +KN +P + PT SP Q+ RLP+ P Y++VLRP L+ Sbjct: 32 YRQEKNKNTSQSPSMAPLNPTATSSPATTLDQNLPWNRYRLPKTLIPDSYNVVLRPYLS 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,050,088 Number of Sequences: 219361 Number of extensions: 222578 Number of successful extensions: 1302 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1299 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)