| Clone Name | bastl43a09 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 88.2 bits (217), Expect = 4e-18 Identities = 35/54 (64%), Positives = 51/54 (94%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 ++A+ +V+YDH+A++I+G +R+L+SGSIHYPRSTP+MWP L+QKAKDGGLDV++ Sbjct: 20 SAASASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQ 73
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 87.0 bits (214), Expect = 1e-17 Identities = 35/53 (66%), Positives = 48/53 (90%) Frame = +2 Query: 203 SAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 + +VTYDH++++I+G RR+L+SGSIHYPRSTP+MWP L+QKAKDGGLDV++ Sbjct: 22 AVTASVTYDHKSVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQ 74
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 82.4 bits (202), Expect = 2e-16 Identities = 31/49 (63%), Positives = 47/49 (95%) Frame = +2 Query: 215 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 +V+YDH+A++++G R++L+SGSIHYPRSTP+MWP L+QKAK+GG+DV++ Sbjct: 23 SVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQ 71
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 82.0 bits (201), Expect = 3e-16 Identities = 36/55 (65%), Positives = 46/55 (83%) Frame = +2 Query: 197 GTSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 G++ +T V++D RA+ IDG RR+L+SGSIHYPRST DMWP L+ KAKDGGLD +E Sbjct: 20 GSANSTIVSHDERAITIDGQRRILLSGSIHYPRSTSDMWPDLISKAKDGGLDTIE 74
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 73.6 bits (179), Expect = 1e-13 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = +2 Query: 215 NVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 NV YD+RA+ I+ RR+L+SGSIHYPRSTP+MWP +++KAKD LDV++ Sbjct: 30 NVWYDYRAIKINDQRRILLSGSIHYPRSTPEMWPDIIEKAKDSQLDVIQ 78
>BGAL_CANFA (Q9TRY9) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 668 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 218 VTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 + Y H + DG +SGSIHY R W + K K GL+ ++ Sbjct: 35 IDYSHNRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQ 82
>BGAL_FELCA (O19015) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 669 Score = 32.0 bits (71), Expect = 0.38 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 218 VTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 + Y H + DG +SGSIHY R W + K K GL+ ++ Sbjct: 35 IDYGHNRFLKDGQPFRYISGSIHYFRVPRFYWKDRLLKMKMAGLNAIQ 82
>BGAL_XANMN (P48982) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 598 Score = 32.0 bits (71), Expect = 0.38 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +2 Query: 242 VIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 V DG L+SG+IH+ R W +QKA+ GL+ VE Sbjct: 38 VRDGKPYQLLSGAIHFQRIPRAYWKDRLQKARALGLNTVE 77
>BGAL_HUMAN (P16278) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 677 Score = 30.8 bits (68), Expect = 0.85 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 T + Y + + DG +SGSIHY R W + K K GL+ ++ Sbjct: 28 TQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQ 81
>BGAM_HUMAN (P16279) Beta-galactosidase-related protein precursor| (Beta-galactosidase-like protein) (S-Gal) (Elastin-binding protein) (EBP) Length = 546 Score = 30.8 bits (68), Expect = 0.85 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 T + Y + + DG +SGSIHY R W + K K GL+ ++ Sbjct: 28 TQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQ 81
>BGAL_MACFA (Q60HF6) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 682 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 T + Y + DG +SGSIHY R W + K K GL+ ++ Sbjct: 28 TRRVFEIAYSQDRFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNTIQ 81
>ATIN_BHV1P (P30020) Alpha trans-inducing protein (Alpha-TIF)| Length = 504 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 301 PRHVAGADAEGQGRRPGR 354 PRH +G+ A QGRRPGR Sbjct: 407 PRHTSGSGAFSQGRRPGR 424
>YEG7_SCHPO (O13989) Protein C26H5.07c in chromosome I precursor| Length = 505 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 328 LHQPRPHVGGAPRVVDGAGDEH-AAHAVDDQ 239 LH RP P ++ G+ DEH A AVDD+ Sbjct: 459 LHHERPTSPANPHIIHGSADEHQALFAVDDE 489
>BGAL_MOUSE (P23780) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) Length = 647 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 200 TSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPGLMQKAKDGGLDVVE 361 T + Y + DG +SGSIHY R W + K K GL+ ++ Sbjct: 29 TQRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRLLKMKMAGLNAIQ 82
>ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein 38 (Zinc| finger protein expressed in neurons) (Zenon) Length = 1203 Score = 28.5 bits (62), Expect = 4.2 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 8 SSPSLHSTSTALLARLVHRTPSSHEQGAVLVAVSSQESDKAMAAVGR 148 SS HS + A LA H++PS L+ S E+DKA R Sbjct: 716 SSVIKHSNAIACLANSNHQSPSQPVASPSLIKDSKPEADKASKLASR 762
>TTGH_PSEPU (Q93PU4) Toluene efflux pump membrane transporter ttgH| Length = 1049 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 122 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 36 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145
>SRPB_PSEPU (O31100) Solvent resistant pump membrane transporter srpB| Length = 1049 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 122 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 36 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145
>NDED_ALCXX (P94211) N-acyl-D-glutamate deacylase (EC 3.5.1.82)| (N-acyl-D-glutamate amidohydrolase) Length = 488 Score = 27.3 bits (59), Expect = 9.4 Identities = 24/102 (23%), Positives = 36/102 (35%) Frame = +2 Query: 14 PSLHSTSTALLARLVHRTPSSHEQGAVLVAVSSQESDKAMAAVGRLPSXXXXXXXXXXXX 193 P L + T +L R V + AV + +A GRL Sbjct: 373 PRLWGSFTRVLGRYVREAELLTLEAAVAKMTALPARVFGLADRGRL---AVGAWADVVVF 429 Query: 194 XGTSAATNVTYDHRALVIDGVRRVLVSGSIHYPRSTPDMWPG 319 + T+D L G+ VLV+G +P++ P PG Sbjct: 430 DADTVCDRATWDAPTLASAGIEHVLVNGCAVFPQAPPSHRPG 471
>RL6_BACST (P02391) 50S ribosomal protein L6 (BL10)| Length = 177 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 17 SLHSTSTALLARLVHRTPSSHEQGAVLVAV---SSQESDKAMAAVG 145 +LH T+ +LLA +V +E+ LV V +S++ K + +VG Sbjct: 62 ALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVG 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,953,054 Number of Sequences: 219361 Number of extensions: 514231 Number of successful extensions: 1887 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1887 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)