| Clone Name | bastl42h02 |
|---|---|
| Clone Library Name | barley_pub |
>YET4_YEAST (P40063) Hypothetical 24.4 kDa protein in SSA4-NUP157 intergenic| region Length = 208 Score = 32.3 bits (72), Expect = 0.53 Identities = 34/141 (24%), Positives = 51/141 (36%), Gaps = 15/141 (10%) Frame = +3 Query: 54 WSPINQGNDCGCFDGESARRGALGRVGASVWRPYILTGLKLDFHYVGLEDYYCLTRLLKK 233 +S N +D CFD + L R G S R L+ TR L + Sbjct: 2 YSNHNLNSDDCCFDWNEEKAAELQRTGVSFDRSLTPQSLRTS------------TRRLSE 49 Query: 234 RSWELGGMTHLDTKPISIGGSPN------------HDQSPEAPS-RIRYDETQETEAGK- 371 + + G H+DT P + + H SP APS R R D+ E+ + Sbjct: 50 ENKQQSGTMHIDTSPSVVSDIISSRRDRSQDFFGPHSSSPIAPSERQRADQRSRLESMRL 109 Query: 372 -SLNEKLTWTNGPYDSSHSMV 431 +K+T G + M+ Sbjct: 110 TRRRDKMTKVRGGLEKMEEMI 130
>TLL1_CHICK (Q9DER7) Tolloid-like protein 1 precursor (EC 3.4.24.-) (Chicken| tolloid-like protein 1) (Metalloprotease colloid) Length = 1008 Score = 30.8 bits (68), Expect = 1.6 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = +3 Query: 63 INQGNDCG-----CFDGESARRGALGRV-GASVWRPYILTGLKLDFHYVGLEDYYCLTRL 224 I Q +C FDGES + LGR+ G+ + P I TG K+ ++ + Sbjct: 816 IEQHQECAYDHLEVFDGESEKSPILGRLCGSKIPEPLIATGNKMFLRFIS-DASVQRKGF 874 Query: 225 LKKRSWELGGMTHLDTKP 278 S E GG +TKP Sbjct: 875 QATHSTECGGRLKAETKP 892
>CG12_CANAL (P43062) G1/S-specific cyclin CLN2| Length = 465 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 189 VGLEDYYCLTRLLKKRSWELGGMTHL 266 V L D YC TR++KK+ ++L G+T L Sbjct: 99 VNLIDRYCSTRIVKKQHYQLLGLTSL 124
>UNC5B_HUMAN (Q8IZJ1) Netrin receptor UNC5B precursor (Unc-5 homolog B) (Unc-5| homolog 2) (p53-regulated receptor for death and life protein 1) Length = 945 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +3 Query: 90 FDGESARRGALGRVGASVWRPYILTGLKLDFHYVGLEDYYCLTRLLKKRSWELGGMTHLD 269 F GES R A+ R+ +V+ P + T L+ LED + + + LGG + Sbjct: 682 FTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEE 741 Query: 270 TKPI 281 KP+ Sbjct: 742 PKPL 745
>TOP1_ECOLI (P06612) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 865 Score = 29.6 bits (65), Expect = 3.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 94 MVNRLGEEPWGEWELQFGVL 153 +VNR+G +PW WE + VL Sbjct: 67 LVNRMGVDPWHNWEAHYEVL 86
>UNC5B_MOUSE (Q8K1S3) Netrin receptor UNC5B precursor (Unc-5 homolog B) (Unc-5| homolog 2) Length = 945 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +3 Query: 90 FDGESARRGALGRVGASVWRPYILTGLKLDFHYVGLEDYYCLTRLLKKRSWELGGMTHLD 269 F GES R A+ R+ +++ P + T L+ LED + + + LGG + Sbjct: 682 FMGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEE 741 Query: 270 TKPI 281 KP+ Sbjct: 742 PKPL 745
>SENP2_RAT (Q9EQE1) Sentrin-specific protease 2 (EC 3.4.22.-)| (Sentrin/SUMO-specific protease SENP2) (Axin-associating molecule) (Axam) Length = 588 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +1 Query: 286 SVVPPIMTNHLKRPQELDTMKPKK-LKQENH*MRS*H 393 S PP +++H + ++DT+K K ++++NH +R+ H Sbjct: 231 STFPPAVSHHSSQRTQMDTLKTKGWMEEQNHGVRTTH 267
>TOP1_SALTY (P0A2I1) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 865 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 94 MVNRLGEEPWGEWELQFGVL 153 +VNR+G +PW W+ + VL Sbjct: 67 LVNRMGVDPWHNWDAHYEVL 86
>TOP1_SALTI (P0A2I2) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 865 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 94 MVNRLGEEPWGEWELQFGVL 153 +VNR+G +PW W+ + VL Sbjct: 67 LVNRMGVDPWHNWDAHYEVL 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,485,694 Number of Sequences: 219361 Number of extensions: 1399179 Number of successful extensions: 3518 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3518 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)