| Clone Name | bastl42f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 38 | 0.005 | 2 | YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II | 28 | 6.8 |
|---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +3 Query: 351 ADDENPEDFIDPETPSGQKK 410 A +ENPEDF+DPETP G++K Sbjct: 111 ASEENPEDFVDPETPLGERK 130
>YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II| Length = 456 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 117 EIGWYGWSRRRGRAPALAWTLRSTARAECP*QVRVLRNF 1 EIG G + + AP+ W LR+ R EC +R R + Sbjct: 392 EIGDIGAQQWKTLAPSERWILRTNIRKECTYDIRYKRPY 430 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,562,850 Number of Sequences: 219361 Number of extensions: 196119 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)