| Clone Name | bastl42b01 |
|---|---|
| Clone Library Name | barley_pub |
>MAUG_METME (Q50233) Methylamine utilization protein mauG precursor| Length = 335 Score = 32.0 bits (71), Expect = 0.46 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +1 Query: 40 LPAALSLLTHAFSTVHLQQLVAD*PWDWEGSIHGVE 147 +P+ ++L+ HAF T L+ L D P+ +GSI G++ Sbjct: 246 VPSQVTLMQHAFKTPSLRDLSIDGPYMHDGSIRGLK 281
>MAUG_METFL (Q50426) Methylamine utilization protein mauG precursor| Length = 333 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/38 (31%), Positives = 25/38 (65%) Frame = +1 Query: 40 LPAALSLLTHAFSTVHLQQLVAD*PWDWEGSIHGVEEL 153 +P ++++ HAF T L+ L + P+ +GS+H ++E+ Sbjct: 244 VPPQVTIMQHAFKTPTLRDLPRNGPFMHDGSMHSLDEV 281
>NIA_LOTJA (P39869) Nitrate reductase [NADH] (EC 1.7.1.1) (NR)| Length = 900 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 181 HGAQQQPPSPALPHHGWILPSP 116 H +PP P L HHG+I P P Sbjct: 99 HPFNSEPPLPRLMHHGFITPVP 120
>NIA2_SOYBN (P39870) Inducible nitrate reductase [NADH] 2 (EC 1.7.1.1) (NR)| Length = 890 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 181 HGAQQQPPSPALPHHGWILPSP 116 H +PP P L HHG+I P P Sbjct: 96 HPFNSEPPLPRLMHHGFITPVP 117
>NIA2_BRANA (P39868) Nitrate reductase [NADH], clone PBNBR1412 (EC 1.7.1.1)| (NR) Length = 911 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 181 HGAQQQPPSPALPHHGWILPSP 116 H +PP P L HHG+I P P Sbjct: 118 HPFNAEPPLPRLMHHGFITPVP 139
>POLG_POWVL (Q04538) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3415 Score = 28.5 bits (62), Expect = 5.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 119 TGKDPSMVWKSWGRRLLLS 175 TGK+ + WKSWG+ +L S Sbjct: 884 TGKESKVSWKSWGKSILWS 902
>NIA1_PHAVU (P39865) Nitrate reductase [NADH] 1 (EC 1.7.1.1) (NR-1)| Length = 881 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 181 HGAQQQPPSPALPHHGWILPSP 116 H +PP P L HG+I PSP Sbjct: 94 HPFNAEPPLPRLMQHGFITPSP 115
>ATN1_RAT (P54258) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1183 Score = 28.1 bits (61), Expect = 6.6 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -3 Query: 199 ARAEEHHGAQQQP---PSPALPHHGWILPSP 116 A A HH QQQP P P HHG P P Sbjct: 474 APAHHHHQQQQQPQPQPQPQQHHHGNSGPPP 504
>ADRB1_MELGA (P07700) Beta-1 adrenergic receptor (Beta-1 adrenoceptor) (Beta-1| adrenoreceptor) (Beta-T) Length = 483 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 181 HGAQQQPPSPALPHHGWILPSPRVSQ 104 +G+Q+QP P LP H IL + R S+ Sbjct: 249 YGSQEQPQPPPLPQHQPILGNGRASK 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,283,831 Number of Sequences: 219361 Number of extensions: 552993 Number of successful extensions: 2024 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2017 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)