| Clone Name | bastl42a02 |
|---|---|
| Clone Library Name | barley_pub |
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 121 IRFGDGAGGLARVRGASGTEATRRCCVGVY 32 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 29.3 bits (64), Expect = 3.2 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS-AVAEPN 121 +K L+ + P A +R TTR P P++PAS VA P+ Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPS 164
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 29.3 bits (64), Expect = 3.2 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS-AVAEPN 121 +K L+ + P A +R TTR P P++PAS VA P+ Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPS 164
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 28.9 bits (63), Expect = 4.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPPAPSPNR 119 P ++ +A VPLAP +PP+P+P R Sbjct: 1129 PPKEGVLAQVPLAPPQPGAPPSPAPAR 1155
>FLIK_ECOLI (P52614) Flagellar hook-length control protein| Length = 375 Score = 28.5 bits (62), Expect = 5.4 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +2 Query: 5 QSKAEILQKINPHAAAPSRLRTTRPPNPSQPASAVAEP 118 QSKAE++ +P AA S L T P+ +QP VA P Sbjct: 195 QSKAEVISTPSPVTAAASPLIT---PHQTQPLPTVAAP 229
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.1 bits (61), Expect = 7.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPPAPSPNR 119 P ++ + VPLAP +PP+P+P R Sbjct: 1129 PPKEGTLTQVPLAPPPPGAPPSPAPAR 1155
>CHS4_NEUCR (Q01285) Chitin synthase 4 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 4) (Class-IV chitin synthase 4) Length = 1195 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPPAPSPN 116 P+QQ+RV S+ P TL P+P+PN Sbjct: 6 PSQQQRVPSISSFPETL---PSPNPN 28
>PHF1_HUMAN (O43189) PHD finger protein 1 (PHF1 protein)| Length = 567 Score = 27.7 bits (60), Expect = 9.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPPAPSPNR 119 P +QR A + A + SPP+PSPN+ Sbjct: 399 PQEQRERAHLQRALQASVSPPSPSPNQ 425 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.294 0.123 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,862,927 Number of Sequences: 219361 Number of extensions: 168980 Number of successful extensions: 585 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 44 (21.7 bits)