| Clone Name | bastl41g05 |
|---|---|
| Clone Library Name | barley_pub |
>STT3_MOUSE (P46978) Oligosaccharyl transferase STT3 subunit homolog (B5)| (Integral membrane protein 1) Length = 705 Score = 81.6 bits (200), Expect = 4e-16 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +2 Query: 242 VLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKSGVYEFWNWFDDR 385 VL+FS RLF+V+++ESVIHEFDPYFNYR T+FL++ G Y+F NWFDDR Sbjct: 28 VLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR 75
>STT3_HUMAN (P46977) Oligosaccharyl transferase STT3 subunit homolog (B5)| (Integral membrane protein 1) (TMC) Length = 705 Score = 81.6 bits (200), Expect = 4e-16 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +2 Query: 242 VLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKSGVYEFWNWFDDR 385 VL+FS RLF+V+++ESVIHEFDPYFNYR T+FL++ G Y+F NWFDDR Sbjct: 28 VLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR 75
>STT3_YEAST (P39007) Oligosaccharyl transferase STT3 subunit| Length = 718 Score = 73.9 bits (180), Expect = 8e-14 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +2 Query: 248 AFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKSGVYEFWNWFDDRT 388 A S RLF+VIK+ES+IHEFDP+FNYR T++L + Y+F NWFDDRT Sbjct: 28 AISSRLFAVIKFESIIHEFDPWFNYRATKYLVNNSFYKFLNWFDDRT 74
>STT3_SCHPO (O94335) Oligosaccharyl transferase stt3 subunit| Length = 752 Score = 69.7 bits (169), Expect = 2e-12 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = +2 Query: 242 VLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKSGVYEFWNWFDDRT 388 V + S RLFSVI+YES+IHEFDP+FN+R ++ L + G Y F NWFD+R+ Sbjct: 34 VASVSSRLFSVIRYESIIHEFDPWFNFRASKILVEQGFYNFLNWFDERS 82
>STT3_CAEEL (P46975) Oligosaccharyl transferase STT3 subunit homolog| Length = 757 Score = 67.8 bits (164), Expect = 6e-12 Identities = 25/47 (53%), Positives = 38/47 (80%) Frame = +2 Query: 245 LAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLSKSGVYEFWNWFDDR 385 + F+ RLF+++++ES+IHEFDP+FNYR T + + G Y+F NWFD+R Sbjct: 31 VGFASRLFAIVRFESIIHEFDPWFNYRATHHMVQHGFYKFLNWFDER 77
>MUC24_HUMAN (Q04900) Putative mucin core protein 24 precursor| (Multi-glycosylated core protein 24) (MGC-24) (MUC-24) (CD164 antigen) Length = 189 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 10 CAKSPNKFSTLHCNATQR--LDGSTAAIPTAFPFVCPPTPELC 132 C S +K +T H N T + T+A T+ P V P PE C Sbjct: 19 CVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETC 61
>PHLPP_HUMAN (O60346) PH domain leucine-rich repeat-containing protein phosphatase| (EC 3.1.3.16) (PH domain leucine-rich repeat protein phosphatase) (Pleckstrin homology domain-containing family E protein 1) (Suprachiasmatic nucleus circadian oscillatory Length = 1717 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -1 Query: 165 EPASGSVIGGPAELWGWGADEGEGCRNSCCAAVEPLRSVAVECAELVGRF 16 +P++G G PA +W G E G +N C A + + L G F Sbjct: 1161 QPSTGDASGAPA-VWSHGYTEASGVKNKLCVAALSVNNFCDNREALYGVF 1209
>PHLPP_MOUSE (Q8CHE4) PH domain leucine-rich repeat-containing protein phosphatase| (EC 3.1.3.16) (PH domain leucine-rich repeat protein phosphatase) (Pleckstrin homology domain-containing family E protein 1) (Suprachiasmatic nucleus circadian oscillatory Length = 1687 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 165 EPASGSVIGGPAELWGWGADEGEGCRNSCCAA 70 +P++G G PA +W G E G +N C A Sbjct: 1117 QPSAGDASGAPA-VWSHGYTEASGVKNKLCVA 1147
>PHLPP_RAT (Q9WTR8) PH domain leucine-rich repeat protein phosphatase (EC| 3.1.3.16) (Pleckstrin homology domain-containing family E protein 1) (Suprachiasmatic nucleus circadian oscillatory protein) Length = 1696 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 165 EPASGSVIGGPAELWGWGADEGEGCRNSCCAA 70 +P++G G PA +W G E G +N C A Sbjct: 1124 QPSAGDASGAPA-VWSHGYTEASGVKNKLCVA 1154
>SYL_BUCAP (Q8K9B9) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 861 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +2 Query: 263 LFSVIKYESVIHEFDPYFNYRVTQFLSKSGV--YEFWNWFDDR 385 L S+IK +++ F P+F +R+ Q+L+K+ YE W F+ + Sbjct: 756 LMSIIK---MLYPFTPHFCFRLWQYLNKNCCIDYETWPTFEKK 795
>TAL_MYCLE (P55193) Transaldolase (EC 2.2.1.2)| Length = 375 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -3 Query: 340 QKLGDAVVEVGIELVDHALVLDH 272 QK+ D++V VG++L+D VL+H Sbjct: 327 QKVFDSLVAVGVDLIDVFAVLEH 349 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,773,287 Number of Sequences: 219361 Number of extensions: 462930 Number of successful extensions: 2001 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2001 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)