| Clone Name | bastl41f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COG1_HUMAN (Q8WTW3) Conserved oligomeric Golgi complex component 1 | 32 | 0.40 | 2 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 31 | 0.69 |
|---|
>COG1_HUMAN (Q8WTW3) Conserved oligomeric Golgi complex component 1| Length = 980 Score = 32.0 bits (71), Expect = 0.40 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 316 TITSSLLLPGLKPSWYVHNVLISLCFQLTEI 224 ++TS + LP +PSWYV + L SLC ++ + Sbjct: 730 SVTSKIRLPA-QPSWYVQSFLFSLCQEINRV 759
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 31.2 bits (69), Expect = 0.69 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 316 TITSSLLLPGLKPSWYVHNVLISLCFQLTEI 224 ++TS + LP +PSWYV + L SLC ++ + Sbjct: 728 SVTSKIRLP-TQPSWYVQSFLFSLCQEVNRV 757 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,389,480 Number of Sequences: 219361 Number of extensions: 267294 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)