| Clone Name | bastl41e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAC1B_RAT (Q02294) Voltage-dependent N-type calcium channel alph... | 30 | 2.2 | 2 | CAC1B_MOUSE (O55017) Voltage-dependent N-type calcium channel al... | 30 | 2.9 | 3 | CAC1B_RABIT (Q05152) Voltage-dependent N-type calcium channel al... | 29 | 3.7 | 4 | ZCH13_HUMAN (Q8WW36) Zinc finger CCHC domain-containing protein 13 | 28 | 6.4 | 5 | CUC3A_HAECO (P16253) Cuticle collagen 3A3 | 28 | 8.3 |
|---|
>CAC1B_RAT (Q02294) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2336 Score = 30.0 bits (66), Expect = 2.2 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 285 MLRLARICAARRHSGRAVSALLARPRPCVVSHSLGHNCH 401 M R A R H + + +L RP P VSH H CH Sbjct: 2018 MKRSISTLAPRPHGTQLCNTVLDRPPPSQVSHHHHHRCH 2056
>CAC1B_MOUSE (O55017) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2327 Score = 29.6 bits (65), Expect = 2.9 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 285 MLRLARICAARRHSGRAVSALLARPRPCVVSHSLGHNCH 401 M R A R H + S +L RP P SH H CH Sbjct: 2009 MKRSISTLAPRPHGTQLCSTVLDRPPPSQASHHHHHRCH 2047
>CAC1B_RABIT (Q05152) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 29.3 bits (64), Expect = 3.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 285 MLRLARICAARRHSGRAVSALLARPRPCVVSHSLGHNCH 401 M R A R H+ R S L RP P H H CH Sbjct: 2020 MKRSISTLAPRPHTARLGSTALDRPAPSQAPHHHHHRCH 2058
>ZCH13_HUMAN (Q8WW36) Zinc finger CCHC domain-containing protein 13| Length = 166 Score = 28.5 bits (62), Expect = 6.4 Identities = 19/58 (32%), Positives = 24/58 (41%) Frame = +3 Query: 225 GSAGGRESGGTLAGRQAGRQMLRLARICAARRHSGRAVSALLARPRPCVVSHSLGHNC 398 G AGGR GG G Q G L C SGR + CV+ ++ +NC Sbjct: 22 GGAGGRRGGGHGRGSQCGSTTLSYTCYCCG--ESGR-------NAKNCVLLGNICYNC 70
>CUC3A_HAECO (P16253) Cuticle collagen 3A3| Length = 295 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 254 HFGWQAGRQADASSCKNLCCKTAFRPCRIRAPRPP 358 HFG + RQA SS +N C++ RP P PP Sbjct: 72 HFGNRTARQAITSSEENGGCESCCRPGPPGPPGPP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,945,075 Number of Sequences: 219361 Number of extensions: 731720 Number of successful extensions: 2742 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2736 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)