| Clone Name | bastl41c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | K1C18_MOUSE (P05784) Keratin, type I cytoskeletal 18 (Cytokerati... | 29 | 6.7 | 2 | K1C18_RAT (Q5BJY9) Keratin, type I cytoskeletal 18 (Cytokeratin-... | 28 | 8.7 | 3 | Y719_METJA (Q58129) Hypothetical ABC transporter ATP-binding pro... | 28 | 8.7 | 4 | NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 pr... | 28 | 8.7 |
|---|
>K1C18_MOUSE (P05784) Keratin, type I cytoskeletal 18 (Cytokeratin-18) (CK-18)| (Keratin-18) (K18) (Cytokeratin endo B) (Keratin D) Length = 422 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 282 SQDLLSSIASIRADYLSRQQTNDTQLSSMVAEQVEQA 392 SQDL +A IRA Y + Q N +L ++Q+E++ Sbjct: 234 SQDLSKIMADIRAQYEALAQKNREELDKYWSQQIEES 270
>K1C18_RAT (Q5BJY9) Keratin, type I cytoskeletal 18 (Cytokeratin-18) (CK-18)| (Keratin-18) (K18) Length = 422 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 282 SQDLLSSIASIRADYLSRQQTNDTQLSSMVAEQVEQA 392 SQDL +A IRA Y Q N +L ++Q+E++ Sbjct: 234 SQDLSKIMADIRAQYEQLAQKNREELDKYWSQQIEES 270
>Y719_METJA (Q58129) Hypothetical ABC transporter ATP-binding protein MJ0719| Length = 600 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 285 QDLLSSIASIRADYLSRQQTNDTQLSSMVAEQVEQAHAG 401 +DLLSSI +I Y + N QL ++ +V + G Sbjct: 428 EDLLSSITNIHTSYYKSEIINPLQLEKLLDREVRELSGG 466
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +3 Query: 312 IRADYLSRQQTNDTQLS---SMVAEQVEQAHAGISA 410 + AD+++R + N+TQ S MV E AH GI+A Sbjct: 2247 VPADWMNRVEMNETQYSEMFGMVLAPAEGAHPGIAA 2282 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,960,624 Number of Sequences: 219361 Number of extensions: 362525 Number of successful extensions: 1181 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1181 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)