| Clone Name | bastl40f09 |
|---|---|
| Clone Library Name | barley_pub |
>SDE3_ARATH (Q8GYD9) Probable RNA helicase SDE3 (EC 3.6.1.-) (Silencing| defective protein 3) Length = 1002 Score = 75.1 bits (183), Expect = 7e-14 Identities = 37/64 (57%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +2 Query: 254 GHHSDDEYSVAGDKPEVEFMDFQNDNTLQDYQS-DDGPVVVTAPFPFVNGKPKSVLVGET 430 G+ SDDEYSV DK E+ F+D+QND + Y D+GPVVV+ PFPF KP+SV VGET Sbjct: 5 GYKSDDEYSVIADKGEIGFIDYQNDGSSGCYNPFDEGPVVVSVPFPFKKEKPQSVTVGET 64 Query: 431 STDT 442 S D+ Sbjct: 65 SFDS 68
>MPC2_RALEU (P17296) Metapyrocatechase 2 (EC 1.13.11.2) (MPC) (CatO2ase)| (Catechol 2,3-dioxygenase II) Length = 320 Score = 33.5 bits (75), Expect = 0.24 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 150 PDGGLIQSNLSAAVPPHLRSPARLRASPRGQ 242 PDG L+Q + P +SPARL +P GQ Sbjct: 121 PDGNLVQVKIGPKTSPSSKSPARLEGAPGGQ 151
>SENP6_HUMAN (Q9GZR1) Sentrin-specific protease 6 (EC 3.4.22.-)| (Sentrin/SUMO-specific protease SENP6) (SUMO-1-specific protease 1) Length = 1112 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 10/45 (22%) Frame = +2 Query: 257 HHSD----------DEYSVAGDKPEVEFMDFQNDNTLQDYQSDDG 361 HH+D DE AG E E +DF D QD SDDG Sbjct: 903 HHTDGLSKIRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDG 947
>VGFR2_HUMAN (P35968) Vascular endothelial growth factor receptor 2 precursor (EC| 2.7.10.1) (VEGFR-2) (Kinase insert domain receptor) (Protein-tyrosine kinase receptor Flk-1) (CD309 antigen) Length = 1356 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Frame = +2 Query: 239 SGFKMGHHSDDEYSVAGDKPEVEFMDF-----QNDNTLQDYQSDDGPVVVTAP 382 SG++ G+HSDD + E E + Q +T Q Q D G + + P Sbjct: 1303 SGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPP 1355
>FAR2_CAEEL (P34383) Fatty-acid and retinol-binding protein 2 precursor| Length = 182 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 281 VAGDKPEVEFMDFQNDNTLQDYQ--SDDGPVVVTAPFPFVNG 400 +AGDKP ++ + + +Y+ SDD +TA FP + G Sbjct: 125 LAGDKPTLDSLKELAKGYIAEYKALSDDAKATITAEFPILTG 166
>IF4B_MOUSE (Q8BGD9) Eukaryotic translation initiation factor 4B (eIF-4B)| Length = 611 Score = 28.9 bits (63), Expect = 5.9 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%) Frame = +2 Query: 230 ASRSGFKMGHHSDDEYSVAGDKPEVEF-------MDFQNDNTLQDYQSDD-GPVVVTAPF 385 + R F G+ DD+Y GD+ E + ++D + DY+ DD GP Sbjct: 276 SGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGP----PQR 331 Query: 386 PFVNGKPKS 412 P +N KP+S Sbjct: 332 PRLNLKPRS 340
>IF4B_HUMAN (P23588) Eukaryotic translation initiation factor 4B (eIF-4B)| Length = 611 Score = 28.9 bits (63), Expect = 5.9 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%) Frame = +2 Query: 230 ASRSGFKMGHHSDDEYSVAGDKPEVEF-------MDFQNDNTLQDYQSDD-GPVVVTAPF 385 + R F G+ DD+Y GD+ E + ++D + DY+ DD GP Sbjct: 276 SGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGP----PQR 331 Query: 386 PFVNGKPKS 412 P +N KP+S Sbjct: 332 PKLNLKPRS 340 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,764,117 Number of Sequences: 219361 Number of extensions: 829394 Number of successful extensions: 2246 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2245 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)