| Clone Name | bastl40c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YFGA_ECOLI (P27434) Putative HTH-type transcriptional regulator ... | 31 | 1.7 | 2 | HM26_CAEEL (P34522) Homeobox protein ceh-26 | 29 | 6.3 |
|---|
>YFGA_ECOLI (P27434) Putative HTH-type transcriptional regulator yfgA| Length = 337 Score = 30.8 bits (68), Expect = 1.7 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = -3 Query: 433 TSSPPETXXXXXXXXXREI*SAPVP---PRQSTKVTPTQPRIQTSDTHMPAA 287 TS+PP + +AP P P+Q+ V+P+Q + T+ T P A Sbjct: 177 TSTPPASVDTTATNTQTPAVTAPAPAVDPQQNAVVSPSQANVDTAATPAPTA 228
>HM26_CAEEL (P34522) Homeobox protein ceh-26| Length = 586 Score = 28.9 bits (63), Expect = 6.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 367 PVPPRQSTKVTPTQPRIQTSDTHMPAAGGG 278 P PP Q + P P + H P AGGG Sbjct: 298 PQPPPQFHPIFPANPLFHMAPPHHPVAGGG 327 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,909,729 Number of Sequences: 219361 Number of extensions: 665426 Number of successful extensions: 2294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2293 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)