| Clone Name | bastl40b03 |
|---|---|
| Clone Library Name | barley_pub |
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 31.2 bits (69), Expect = 0.71 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Frame = -1 Query: 237 QGEKRRWRERPNAQHMGISHPPPPASES---------RAGDGPPPA 127 Q + ++ P QH G+ PPPP + G GPPPA Sbjct: 1272 QAAGQHQQQHPQHQHPGLPGPPPPQQQQGQQGQQPPPSVGGGPPPA 1317
>MTF1_HUMAN (Q14872) Metal-regulatory transcription factor 1 (Transcription| factor MTF-1) (MRE-binding transcription factor) Length = 753 Score = 30.8 bits (68), Expect = 0.92 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 216 RERPNAQHMGISHPPPPASESRAGDGP 136 +ER +++ G S PPPP +A DGP Sbjct: 643 KERASSRRKGCSSPPPPEPSPQAPDGP 669
>YBX2B_XENLA (P45441) Y-box-binding protein 2-B (Cytoplasmic RNA-binding protein| p54) (mRNP3) Length = 324 Score = 30.8 bits (68), Expect = 0.92 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 237 QGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPPASD 121 +GE +R R RP Q PP ES+A PAS+ Sbjct: 257 EGEPQRQRNRPYVQRRRAQQPPTVQGESKAEPSEHPASE 295
>PS1C2_MOUSE (Q80ZC9) Psoriasis susceptibility 1 candidate gene 2 protein| homolog precursor (SPR1 protein) Length = 134 Score = 30.8 bits (68), Expect = 0.92 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 240 PQGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPPASD*WPVG 106 P G R WR+ P++ G P PP+++ PP D WP G Sbjct: 64 PPGSNRPWRDLPDS---GAWPPKPPSTDP---PKPPLPDDPWPAG 102
>DIA_DROME (P48608) Protein diaphanous| Length = 1091 Score = 30.8 bits (68), Expect = 0.92 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 189 GISHPPPPASESRAGDGPPP 130 G PPPP RAG GPPP Sbjct: 522 GAPPPPPPPMPGRAGGGPPP 541
>GLP_HORSE (P02726) Glycophorin HA| Length = 120 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -1 Query: 225 RRWRERPNAQHMGISHPPPPASESRAGDGPPPASD 121 RR R+RP A PPPAS + D PPP S+ Sbjct: 74 RRLRKRPPAD------VPPPASTVPSADAPPPVSE 102
>ATX7_HUMAN (O15265) Ataxin-7 (Spinocerebellar ataxia type 7 protein)| Length = 892 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 237 QGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPPAS 124 Q ++++ ++ P Q HPPPP +R DG P A+ Sbjct: 31 QQQQQQQQQPPPPQPQRQQHPPPPPRRTRPEDGGPGAA 68
>CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing protein C19orf7| Length = 1303 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 177 PPPPASESRAGDGPPPASD*WPVGGVTDARTA 82 PPPP SES PPP S P DAR A Sbjct: 8 PPPPPSESPPPPSPPPPSTPSPPPCSPDARPA 39
>CABL2_MOUSE (Q8K3M5) CDK5 and ABL1 enzyme substrate 2 (Interactor with CDK3 2)| (Ik3-2) Length = 481 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 177 PPPPASESRAGDGPPPASD*WPVGGV 100 PPPP +E+R PPPA P GG+ Sbjct: 73 PPPPPTEAREAPAPPPA----PPGGL 94
>TRUB_HALSA (Q9HPA4) Probable tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 301 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 103 PADGPLIACRWRPVAGSRLACWGRRVRDP 189 PADG L+AC AG C GR V DP Sbjct: 261 PADGALVACY---TAGGTAVCLGRLVGDP 286
>WASF4_HUMAN (Q8IV90) Wiskott-Aldrich syndrome protein family member 4| (WASP-family protein member 4) Length = 625 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 207 PNAQHMGISHPPPPASESRAGDGPPPASD*WP 112 P +GI PPPP G PPP+S +P Sbjct: 453 PPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFP 484
>PRP1_HUMAN (P04280) Basic salivary proline-rich protein 1 precursor (Salivary| proline-rich protein) [Contains: Basic peptide IB-6; Peptide P-H] Length = 392 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -1 Query: 240 PQGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPP 130 PQG+K R + P + G PPP G PPP Sbjct: 265 PQGDKSRSPQSPPGKPQG---PPPQGGNQPQGPPPPP 298 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 240 PQGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPP 130 PQG+K R P + G PPP G PPP Sbjct: 82 PQGDKSRSPRSPPGKPQG---PPPQGGNQPQGPPPPP 115
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 177 PPPPASESRAGDGPPPASD*WPVGGVTDARTA 82 PPPP SES PPP S P D R A Sbjct: 8 PPPPPSESPPPPSPPPPSTPSPPPCSPDGRAA 39
>CABL2_HUMAN (Q9BTV7) CDK5 and ABL1 enzyme substrate 2 (Interactor with CDK3 2)| (Ik3-2) Length = 478 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 210 RPNAQHMGISHPPPPASESRAGDGPPP 130 RP + G PPPP +E+R PPP Sbjct: 60 RPPSLGPGGEKPPPPPAEAREPPAPPP 86
>RBLL_CHRVI (Q93UZ0) Ribulose bisphosphate carboxylase-like protein| (RuBisCO-like protein) Length = 457 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -2 Query: 212 SAPMRSTWGSLTR---LPQQASREPATGLHLQAINGPSAG*QTLAQPSQRYSCPAAA 51 +A +R W ++ L ++A R P + A P+ G QPS++ S P AA Sbjct: 397 AASIRQAWEAIVAGETLEERAKRHPELSAAIAAFGKPAHGQAASPQPSEQASEPDAA 453
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 228 KRRWRERPNAQHMGISHPPPPASESRAGDGPPPAS 124 +++ +++P M PPPPA+ +R G GPP S Sbjct: 72 QQQQQQQPRPSPMARPGPPPPAAMARPG-GPPQVS 105
>WASL_HUMAN (O00401) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 177 PPPPASESRAGDGPPP 130 PPPPA S A GPPP Sbjct: 345 PPPPALPSSAPSGPPP 360
>TSP2_BOVIN (Q95116) Thrombospondin-2 precursor (Corticotropin-induced secreted| protein) (CISP) Length = 1170 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 238 SGRETQVARAPQCAAHGDLSPASP 167 SGRET+ + P C G SP SP Sbjct: 477 SGRETKACQGPPCPVDGRWSPWSP 500
>K1543_MOUSE (Q80VC9) Protein KIAA1543| Length = 1252 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -1 Query: 240 PQGEKRRWRERPNAQHMGISHPPPPASESRAGDG----PPPASD 121 P+G + +R N + ISHP P+ S G PPP S+ Sbjct: 503 PEGASKPLSDRLNKAPIYISHPENPSKSSPCSTGEILKPPPPSE 546
>WASL_RAT (O08816) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 177 PPPPASESRAGDGPPP 130 PPPPA S A GPPP Sbjct: 342 PPPPALPSSAPSGPPP 357
>WASL_MOUSE (Q91YD9) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 177 PPPPASESRAGDGPPP 130 PPPPA S A GPPP Sbjct: 342 PPPPALPSSAPSGPPP 357
>ARHGB_HUMAN (O15085) Rho guanine nucleotide exchange factor 11 (PDZ-RhoGEF)| Length = 1522 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 10/49 (20%) Frame = -1 Query: 243 LPQGEKRRWRE------RPNAQHMGIS----HPPPPASESRAGDGPPPA 127 L +K W E R +H G + HPPPP A GP P+ Sbjct: 1062 LTSSDKNTWMELLEEAVRNATRHPGAAPMPVHPPPPGPREPAQQGPTPS 1110
>ENA_DROME (Q8T4F7) Protein enabled| Length = 834 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -1 Query: 240 PQGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPPA 127 P + + P MG PP P + G GPPPA Sbjct: 575 PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPA 612 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 177 PPPPASESRAGDGPPP 130 PPPP+ AG GPPP Sbjct: 560 PPPPSFGGAAGGGPPP 575
>TCGAP_HUMAN (O14559) TC10/CDC42 GTPase-activating protein (Sorting nexin 26)| Length = 1287 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 228 KRRWRERPNAQHMGISHPPPPASESRAGDGPPP 130 K R + P M PPPP S R G PPP Sbjct: 859 KLRGAQGPLGPDMESPLPPPPLSLLRPGGAPPP 891
>FXR2_HUMAN (P51116) Fragile X mental retardation syndrome-related protein 2| Length = 673 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = -1 Query: 216 RERPNAQHMGISHPPPPASESR------AGDGPPPA 127 RE PN G PP ESR G GPPPA Sbjct: 460 REEPNRAGPGDRDPPTRGEESRRRPTGGRGRGPPPA 495
>PRB2_HUMAN (P02812) Basic salivary proline-rich protein 2 (Salivary| proline-rich protein) (Con1 glycoprotein) [Contains: Basic peptide P-F] (Fragment) Length = 382 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 240 PQGEKRRWRERPNAQHMGISHPPPPASESRAGDGPPP 130 PQG+K R P + G PPP G PPP Sbjct: 69 PQGDKSRSPRSPPGKPQG---PPPQGGNQPQGPPPPP 102
>CNGB1_BOVIN (Q28181) 240 kDa protein of rod photoreceptor CNG-channel [Contains:| Glutamic acid-rich protein (GARP); Cyclic-nucleotide-gated cation channel 4 (CNG channel 4) (CNG-4) (Cyclic nucleotide-gated cation channel modulatory subunit)] Length = 1394 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 177 PPPPASESRAGDGPPPASD*WPVGGVTDARTAE 79 P PA E+ A PPPAS P G AR E Sbjct: 1310 PEAPAPEAPAPSSPPPASQERPEGDKDAARPEE 1342
>TRUB_THET8 (Q5SLS6) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 312 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 135 EARRRLSTRLLGEAGERSPCA 197 EARRRLSTR +G G P A Sbjct: 20 EARRRLSTRRVGHTGTLDPLA 40
>TRUB_THET2 (Q72GS9) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 312 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 135 EARRRLSTRLLGEAGERSPCA 197 EARRRLSTR +G G P A Sbjct: 20 EARRRLSTRRVGHTGTLDPLA 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,210,741 Number of Sequences: 219361 Number of extensions: 862373 Number of successful extensions: 4456 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 3410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4345 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)