| Clone Name | bastl38g03 |
|---|---|
| Clone Library Name | barley_pub |
>GCP3_MOUSE (P58854) Gamma-tubulin complex component 3 (GCP-3)| Length = 905 Score = 44.7 bits (104), Expect = 1e-04 Identities = 26/80 (32%), Positives = 38/80 (47%) Frame = +2 Query: 68 DEHQTQDLVKELVLRLXXXXXXXXXXXLRFAHRLLSSRLATAVLPDEHAVAEAIKRRLAA 247 D+ L++ L R+ +FA R++ S A V DE VAE IK+ L Sbjct: 5 DQKSPNVLLQNLCCRILGRSEADVAQQFQFAVRVIGSNFAPTVERDEFLVAEKIKKELIR 64 Query: 248 SGRPDDALAFADLHAKLSAR 307 R DA F++LH KL ++ Sbjct: 65 QRREADAALFSELHRKLHSQ 84
>GCP3_HUMAN (Q96CW5) Gamma-tubulin complex component 3 (GCP-3) (Spindle pole| body protein Spc98 homolog) (hSpc98) (hGCP3) (h104p) Length = 907 Score = 43.5 bits (101), Expect = 3e-04 Identities = 25/80 (31%), Positives = 38/80 (47%) Frame = +2 Query: 68 DEHQTQDLVKELVLRLXXXXXXXXXXXLRFAHRLLSSRLATAVLPDEHAVAEAIKRRLAA 247 D+ L++ L R+ ++A R++ S A V DE VAE IK+ L Sbjct: 5 DQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIR 64 Query: 248 SGRPDDALAFADLHAKLSAR 307 R DA F++LH KL ++ Sbjct: 65 QRREADAALFSELHRKLHSQ 84
>BHLH8_MOUSE (Q9QYC3) Class B basic helix-loop-helix protein 8 (bHLHB8) (Muscle,| intestine and stomach expression 1) (MIST-1) Length = 197 Score = 28.9 bits (63), Expect = 7.8 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -1 Query: 285 RSAKARASSGRPEAARRRLMASATACSSGR--TAVARRLESS 166 RS ARAS GR E +RRR S GR +V RRLES+ Sbjct: 43 RSRTARASGGRGEVSRRR------QGSGGRRENSVQRRLESN 78
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 8 PKPPSNQLSRPPGSNPITPMDEHQTQDLVKELVLRL 115 P PP NQ PPG + PMD++ V V RL Sbjct: 428 PPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRL 463
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 8 PKPPSNQLSRPPGSNPITPMDEHQTQDLVKELVLRL 115 P PP NQ PPG + PMD++ V V RL Sbjct: 428 PPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRL 463 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.304 0.130 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,601,819 Number of Sequences: 219361 Number of extensions: 439831 Number of successful extensions: 1402 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1401 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.8 bits)