| Clone Name | bastl38b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MK04_MOUSE (Q6P5G0) Mitogen-activated protein kinase 4 (EC 2.7.1... | 32 | 1.1 | 2 | MK04_RAT (Q63454) Mitogen-activated protein kinase 4 (EC 2.7.11.... | 32 | 1.1 | 3 | MK04_HUMAN (P31152) Mitogen-activated protein kinase 4 (EC 2.7.1... | 30 | 2.5 | 4 | APPA_BACSU (P42061) Oligopeptide-binding protein appA precursor | 28 | 9.6 |
|---|
>MK04_MOUSE (Q6P5G0) Mitogen-activated protein kinase 4 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 4) (ERK-4) Length = 583 Score = 31.6 bits (70), Expect = 1.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 273 YGPAHSFDAAGTALDSAPSCRPWERGDLLRRLATFKPSTWDAK 401 + AH + LD+ P R ++ +LLR + +F STW+ K Sbjct: 229 FAGAHELEQMQLILDTIPVVREEDKEELLRVMPSFVSSTWEVK 271
>MK04_RAT (Q63454) Mitogen-activated protein kinase 4 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 4) (ERK-4) (MAP kinase isoform p63) (p63-MAPK) (MNK2) (Fragment) Length = 274 Score = 31.6 bits (70), Expect = 1.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 273 YGPAHSFDAAGTALDSAPSCRPWERGDLLRRLATFKPSTWDAK 401 + AH + LD+ P R ++ +LLR + +F STW+ K Sbjct: 203 FAGAHELEQMQLILDTIPVVREEDKEELLRVMPSFVSSTWEVK 245
>MK04_HUMAN (P31152) Mitogen-activated protein kinase 4 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 4) (ERK-4) (MAP kinase isoform p63) (p63-MAPK) Length = 557 Score = 30.4 bits (67), Expect = 2.5 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 273 YGPAHSFDAAGTALDSAPSCRPWERGDLLRRLATFKPSTWDAK 401 + AH + L++ P R ++ +LLR + +F STW+ K Sbjct: 229 FAGAHELEQMQLILETIPVIREEDKDELLRVMPSFVSSTWEVK 271
>APPA_BACSU (P42061) Oligopeptide-binding protein appA precursor| Length = 543 Score = 28.5 bits (62), Expect = 9.6 Identities = 9/40 (22%), Positives = 22/40 (55%) Frame = -3 Query: 330 KMVQNPKQFQQHQSYEQAHRHVVQRVMRNQPWKPVCYPAN 211 K++++ K + Y + + + Q++ +QP+ + YP N Sbjct: 475 KLMKDAKSISDRKQYSKEYEQIYQKIAEDQPYTFLYYPNN 514 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,604,234 Number of Sequences: 219361 Number of extensions: 840185 Number of successful extensions: 2476 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2472 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)