| Clone Name | bastl33h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UPP_MYCPA (Q73UD7) Uracil phosphoribosyltransferase (EC 2.4.2.9)... | 33 | 0.28 | 2 | VTER_EBV (P03219) Probable DNA packaging protein | 30 | 3.1 |
|---|
>UPP_MYCPA (Q73UD7) Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP| pyrophosphorylase) (UPRTase) Length = 257 Score = 33.5 bits (75), Expect = 0.28 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -2 Query: 293 PNREEAPLARGEAASKSVASNTAWMDLPSAPSQSSR 186 P+R EAP RG AA+K+ +A + PS+ S S+R Sbjct: 214 PSRPEAPAGRGRAAAKTPGRRSARSESPSSTSPSAR 249
>VTER_EBV (P03219) Probable DNA packaging protein| Length = 690 Score = 30.0 bits (66), Expect = 3.1 Identities = 20/64 (31%), Positives = 32/64 (50%) Frame = +2 Query: 215 DPSRLCC*PRICSLPRLVLAEPLHGSARLCSSRSQLVFKEFWGFRNPRAMEPGDTKFDAS 394 DP+ L + SL + + H ARL + + Q+V F+ + +++E DT FD Sbjct: 141 DPNFLEMREFVTSLASFLSGQYKHKPARLEAFQKQVVLHSFYFLISIKSLEITDTMFDIF 200 Query: 395 QYAF 406 Q AF Sbjct: 201 QSAF 204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,664,315 Number of Sequences: 219361 Number of extensions: 852318 Number of successful extensions: 2136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2136 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)