| Clone Name | bastl33e07 |
|---|---|
| Clone Library Name | barley_pub |
>IF2_AZOSE (Q5NZS1) Translation initiation factor IF-2| Length = 945 Score = 36.2 bits (82), Expect = 0.019 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 EP P P P+ PEP+P +P T ESG A P RA P Sbjct: 162 EPEPEPEPEPEPQPEPEPRPEPEPATVESG--APAKPEAPVRAPSRP 206
>PGCA_BOVIN (P13608) Aggrecan core protein precursor (Cartilage-specific| proteoglycan core protein) (CSPCP) Length = 2364 Score = 35.0 bits (79), Expect = 0.043 Identities = 18/36 (50%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 KP PS EP+P P P P EP PSE+P SE Sbjct: 847 KPIPSEEPFPSEEPFPSEKPFPPEEPFPSEKPIPSE 882 Score = 34.7 bits (78), Expect = 0.056 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSES-GRLAAVSPS 138 KP P EP+P P+P + P +P PSE+P SE L+A PS Sbjct: 865 KPFPPEEPFPSEKPIPSEEPFPSEKPFPSEEPFPSEEPSTLSAPVPS 911 Score = 34.3 bits (77), Expect = 0.074 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 KP PS EP+P P P + P +P PSE+P SE Sbjct: 823 KPFPSEEPFPSEKPFPPEELFPSEKPIPSEEPFPSE 858 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 +P PS EP+P P P + P +P PSE+P SE Sbjct: 853 EPFPSEEPFPSEKPFPPEEPFPSEKPIPSEEPFPSE 888 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 +P P EP+P P P + P +P PSE+P SE Sbjct: 793 EPFPPEEPFPSEKPFPPEELFPSEKPFPSEKPFPSE 828 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 KP PS EP+P P P P E PSE+P SE Sbjct: 787 KPFPSEEPFPPEEPFPSEKPFPPEELFPSEKPFPSE 822 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 KP PS +P+P P P P E PSE+P SE Sbjct: 817 KPFPSEKPFPSEEPFPSEKPFPPEELFPSEKPIPSE 852
>SLAP1_CLOTM (Q06852) Cell surface glycoprotein 1 precursor (Outer layer protein| B) (S-layer protein 1) Length = 1664 Score = 34.3 bits (77), Expect = 0.074 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSES 111 +P PS EP P P P + P EP PS++PT SE+ Sbjct: 1339 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 1375 Score = 34.3 bits (77), Expect = 0.074 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSES 111 +P PS EP P P P + P EP PS++PT SE+ Sbjct: 1284 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 1320 Score = 34.3 bits (77), Expect = 0.074 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSES 111 +P PS EP P P P + P EP PS++PT SE+ Sbjct: 1014 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 1050 Score = 34.3 bits (77), Expect = 0.074 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSES 111 +P PS EP P P P + P EP PS++PT SE+ Sbjct: 959 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSET 995 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1333 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1368 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1278 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1313 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1008 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 1043 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 953 EPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSD 988 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 1235 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 1265 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 1192 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 1222 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 1149 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 1179 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 1106 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 1136 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 1063 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 1093 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 910 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 940 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 867 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 897 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 824 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 854 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P PS EP P P P + EP PS++PT SE+ Sbjct: 781 EPTPSDEPTPSDEPTP----SDEPTPSDEPTPSET 811 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 7 KP*PSLEPYPLASPL-PDRDTAPEPKPSEQPTTSESG 114 +P PS EP P +P P T P P PS PT+ G Sbjct: 1363 EPTPSDEPTPSETPEEPTPTTTPTPTPSTTPTSGSGG 1399 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGA 147 +P PS EP P P P + P P E T+ + +P+ G+ Sbjct: 1351 EPTPSDEPTPSDEPTPSDEPTPSETPEEPTPTTTPTPTPSTTPTSGS 1397 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1330 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1356 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1323 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1350 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1275 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1301 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1268 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1295 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1232 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1258 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1225 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1252 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1189 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1215 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1182 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1209 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1146 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1172 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1139 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1166 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1103 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1129 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1096 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1123 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1060 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1086 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 1053 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1080 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 1005 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 1031 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 998 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 1025 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 950 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 976 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 943 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 970 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 907 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 933 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 900 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 927 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 864 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 890 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 857 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 884 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 821 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 847 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 814 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 841 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 PS EP P P P + EP PS++PT S+ Sbjct: 778 PSDEPTPSDEPTP----SDEPTPSDEPTPSD 804 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSE 108 EP P +P + + EP PS++PT S+ Sbjct: 771 EPIPTDTPSDEPTPSDEPTPSDEPTPSD 798 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1296 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1344 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1241 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1289 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1198 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1246 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1155 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1203 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1112 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1160 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1069 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1117 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 1026 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1074 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 971 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 1019 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 916 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 964 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 873 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 921 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 830 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 878 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 15/49 (30%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP---------------EPKPSEQPTTSE 108 +P PS EP P P P + P EP PS++PT S+ Sbjct: 787 EPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSD 835
>ACFD_ECOLI (Q46837) Putative lipoprotein acfD homolog precursor| Length = 1520 Score = 34.3 bits (77), Expect = 0.074 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P P+ +P P P+PD + PEP+P PT Sbjct: 60 PEPTPDPEPTPEPIPDPEPTPEPEPEPVPT 89 Score = 34.3 bits (77), Expect = 0.074 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 KP P+ P P P PD + PEP P +PT Sbjct: 49 KPDPTPNPEPTPEPTPDPEPTPEPIPDPEPT 79
>PGCA_HUMAN (P16112) Aggrecan core protein precursor (Cartilage-specific| proteoglycan core protein) (CSPCP) (Chondroitin sulfate proteoglycan core protein 1) [Contains: Aggrecan core protein 2] Length = 2415 Score = 33.9 bits (76), Expect = 0.096 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 8/42 (19%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--------EPKPSEQPTTSE 108 +P PS EP+P P P + P EP PSE+P+ SE Sbjct: 797 EPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASE 838
>PTN23_HUMAN (Q9H3S7) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) (His-domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) Length = 1636 Score = 33.9 bits (76), Expect = 0.096 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPK--------PSEQPTTSESGRLAAVSP 135 P PS P PL+SPLP+ AP+PK PS P +S LA+++P Sbjct: 1539 PIPSSSPPPLSSPLPE---APQPKEEPPVPEAPSSGPPSSSLELLASLTP 1585
>PTN23_MOUSE (Q6PB44) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) Length = 1692 Score = 33.5 bits (75), Expect = 0.13 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPS 138 P PS P PL+SPLP+ P+P E+P+ E+ L S S Sbjct: 1595 PVPSSSPPPLSSPLPE-----APQPEEEPSVPEAPSLGPPSSS 1632 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P + P+P+P QP Sbjct: 988 QPQPQPQPQPQPQPQPQSQSQPQPQPQPQP 1017 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 +P P +P P P P + +P+P QP P+ G + Q P Sbjct: 986 QPQPQPQPQPQPQPQPQPQSQSQPQPQPQPQPQR--------PAFGPQPTQQP 1030
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 KP P P P SP P + P+PKP PT S Sbjct: 11 KPQPKPPPAPTPSPCPPQPPKPQPKPPPAPTPS 43 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 KP P P P SP P + P+PKP P S Sbjct: 31 KPQPKPPPAPTPSPCPPQPPKPQPKPPPAPGPS 63
>CLFB_STAAS (Q6G644) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 905 Score = 33.1 bits (74), Expect = 0.16 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS +P P SP PD + P+P+PS P Sbjct: 554 PEPSPDPEPEPSPDPDPEPTPDPEPSPDP 582 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P ++P P P P+ P+P+P+ P S Sbjct: 548 PGPPVDPEPSPDPEPEPSPDPDPEPTPDPEPS 579
>CLFB_STAAW (Q8NUL0) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 907 Score = 33.1 bits (74), Expect = 0.16 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS +P P SP PD + P+P+PS P Sbjct: 554 PEPSPDPEPEPSPDPDPEPTPDPEPSPDP 582 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P ++P P P P+ P+P+P+ P S Sbjct: 548 PGPPVDPEPSPDPEPEPSPDPDPEPTPDPEPS 579
>VGLI_PRVRI (P07646) Glycoprotein GP63 precursor| Length = 350 Score = 33.1 bits (74), Expect = 0.16 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKP-SEQPTTSESGRLAAVSPSHG 144 P +EP P +P P R T P+P S++ E G A++P G Sbjct: 208 PPIEPEPPTTPAPPRGTGATPEPRSDEEEEDEEGATTAMTPVPG 251
>TONB_PSEAE (Q51368) Protein tonB| Length = 342 Score = 33.1 bits (74), Expect = 0.16 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGA 147 K KP P +P P+ + +P PEPKP +P S + SPS A Sbjct: 170 KPKPKPKPKPKPVENAIPKAKPKPEPKPKPEPEPSTEAS-SQPSPSSAA 217 Score = 32.3 bits (72), Expect = 0.28 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPS 138 K KP P P A P P+ PEP+PS + ++ S AA P+ Sbjct: 176 KPKPKPVENAIPKAKPKPEPKPKPEPEPSTEASSQPSPSSAAPPPA 221 Score = 24.6 bits (52), Expect(2) = 9.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 K KP +P P P P + P+ KP +P Sbjct: 164 KPKPVEKPKPKPKPKPKPVENAIPKAKPKPEP 195 Score = 21.2 bits (43), Expect(2) = 9.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 12/41 (29%) Frame = +2 Query: 170 PSSVAALRPSPS-----------RGLPRAALAPQGRR-PAG 256 PS+ A+ +PSPS + P A AP G + PAG Sbjct: 203 PSTEASSQPSPSSAAPPPAPTVGQSTPGAQTAPSGSQGPAG 243
>CCNB1_HUMAN (P14635) G2/mitotic-specific cyclin-B1| Length = 433 Score = 32.7 bits (73), Expect = 0.21 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKP------SEQPTTSESGRLAAVSPSHGARAEQD 162 P L P P++ P+P+ + PEP+P S +P ++ + + S A AE+D Sbjct: 87 PMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEED 141 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 22 LEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLA 123 LE P+ P+P + PEP+P +P + +L+ Sbjct: 83 LEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLS 116
>COLI2_CYPCA (Q9YGK5) Corticotropin-lipotropin 2 precursor| (Corticotropin-lipotropin II) (Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediary pep Length = 222 Score = 32.3 bits (72), Expect = 0.28 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -2 Query: 315 EAHLAPTSLSLPASHLTPLAPAGLLPCGASAARGSPRDGLGRS 187 E+HL P S A L PL+PA L P SPR L RS Sbjct: 66 ESHLQPPSELEQAEVLEPLSPAALAPAEQMDPESSPRHELKRS 108
>PGCA_PIG (Q29011) Aggrecan core protein (Cartilage-specific proteoglycan| core protein) (CSPCP) (Fragments) Length = 537 Score = 32.3 bits (72), Expect = 0.28 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKP--SEQPTTSES-GRLAAVSPS 138 +P PS +P+P P P + P KP SE+P SE L+A PS Sbjct: 475 EPFPSEKPFPSEEPFPSEEPFPSEKPSASEEPFPSEQPSTLSAPVPS 521 Score = 32.3 bits (72), Expect = 0.28 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAP--EPKPSEQPTTSE 108 P S EP+P P P + P EP PSE+P+ SE Sbjct: 470 PSTSEEPFPSEKPFPSEEPFPSEEPFPSEKPSASE 504
>CLFB_STAAR (Q6GDH2) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 873 Score = 32.3 bits (72), Expect = 0.28 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P ++P P P PD + +PEP+P P S Sbjct: 548 PGPPVDPEPEPEPTPDPEPSPEPEPEPTPDPEPS 581 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP-TTSESGRLAAVSPSHGARAEQD 162 +P P P P SP P+ + P+P+PS +P S+S + G+ ++ D Sbjct: 555 EPEPEPTPDPEPSPEPEPEPTPDPEPSPEPDPDSDSDSDSGSDSDSGSDSDSD 607
>NOL3_RAT (Q62881) Nucleolar protein 3| Length = 221 Score = 32.0 bits (71), Expect = 0.37 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +EP P P P+ + PEP+P +P Sbjct: 174 EPEPEVEPEPEPEPEPEPEPEPEPEPEPEP 203 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 P EP P P P+ + PEP+P +P E Sbjct: 181 PEPEPEPEPEPEPEPEPEPEPEPEREPDFQE 211
>CLFB_STAAN (Q7A382) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 877 Score = 31.6 bits (70), Expect = 0.48 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP---TTSESG 114 +P P EP P P P D PEP P P + S+SG Sbjct: 555 EPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSG 593 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS +P P +P P+ PEP+PS P Sbjct: 554 PEPSPDPEPEPTPDPEPSPDPEPEPSPDP 582 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P ++P P P P+ PEP P +P S Sbjct: 548 PGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPS 579
>CLFB_STAAM (Q99R07) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 877 Score = 31.6 bits (70), Expect = 0.48 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP---TTSESG 114 +P P EP P P P D PEP P P + S+SG Sbjct: 555 EPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSG 593 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS +P P +P P+ PEP+PS P Sbjct: 554 PEPSPDPEPEPTPDPEPSPDPEPEPSPDP 582 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P ++P P P P+ PEP P +P S Sbjct: 548 PGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPS 579
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 31.6 bits (70), Expect = 0.48 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P SP P +P P PS P S S Sbjct: 341 PTPSPSPSPSPSPSPSPSPSPSPSPSPSPIPSPS 374 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS P P SP P +P PKPS P Sbjct: 353 PSPSPSPSPSPSPSPSPIPSPSPKPSPSP 381 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P PS P P SP P +P P PS +P+ S Sbjct: 349 PSPSPSPSPSPSPSPSPSPSPIPSPSPKPSPS 380 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P SP P +P P PS P S S Sbjct: 347 PSPSPSPSPSPSPSPSPSPSPSPIPSPSPKPSPS 380 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAV 129 P PS P P SP P +P P P P+ S AV Sbjct: 345 PSPSPSPSPSPSPSPSPSPSPSPSPIPSPSPKPSPSPVAV 384 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P A P P +P P PS P+ S S Sbjct: 330 PAPSPPPSP-APPTPSPSPSPSPSPSPSPSPSPS 362
>CLFB_STAAU (O86476) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 913 Score = 31.6 bits (70), Expect = 0.48 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP---TTSESG 114 +P P EP P P P D PEP P P + S+SG Sbjct: 555 EPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSG 593 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS +P P +P P+ PEP+PS P Sbjct: 554 PEPSPDPEPEPTPDPEPSPDPEPEPSPDP 582 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P ++P P P P+ PEP P +P S Sbjct: 548 PGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPS 579
>CLFB_STAAC (Q5HCR7) Clumping factor B precursor (Fibrinogen-binding protein B)| (Fibrinogen receptor B) Length = 913 Score = 31.6 bits (70), Expect = 0.48 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP---TTSESG 114 +P P EP P P P D PEP P P + S+SG Sbjct: 555 EPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSG 593 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P PS +P P +P P+ PEP+PS P Sbjct: 554 PEPSPDPEPEPTPDPEPSPDPEPEPSPDP 582 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P ++P P P P+ PEP P +P S Sbjct: 548 PGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPS 579
>ST2B1_HUMAN (O00204) Sulfotransferase family cytosolic 2B member 1 (EC 2.8.2.2)| (Sulfotransferase 2B1) (Alcohol sulfotransferase) (Hydroxysteroid sulfotransferase 2) Length = 365 Score = 31.6 bits (70), Expect = 0.48 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTS---ESGRLAAVSPSHGARAE 156 +P SP P+ PEPKPS +P TS E ++ SPS G +E Sbjct: 312 DPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASE 358 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P PS EP P S P+ EP+P+ P+ S Sbjct: 321 PEPSPEPEPKPSLEPNTSLEREPRPNSSPSPS 352
>HSP70_TRIRU (O93866) Heat shock 70 kDa protein| Length = 654 Score = 31.6 bits (70), Expect = 0.48 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 258 APAGLLPCGASAARGSPRDGLGRSAATDDGPRV 160 AP G GA G P G G +AA DDGP V Sbjct: 618 APGGFPGAGAGGPGGFPGAGAGGAAAHDDGPTV 650
>YCGV_ECOLI (P76017) Hypothetical protein ycgV| Length = 955 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P P P P+ + D PEP P+ +PTT+ Sbjct: 625 PNPEPTPAPAQPPIVNPDPTPEPAPTPKPTTT 656
>PML_HUMAN (P29590) Probable transcription factor PML (Tripartite motif| protein 19) (RING finger protein 71) Length = 882 Score = 31.6 bits (70), Expect = 0.48 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 22 LEPYPLASPLPDRDTA-PEPKPSEQPTTSESGRLAAVSPSHGARA 153 +EP P SP P +D A P+ P T GR + SPS RA Sbjct: 1 MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERA 45
>IF2_CHRVO (Q7NY13) Translation initiation factor IF-2| Length = 964 Score = 31.6 bits (70), Expect = 0.48 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 6/58 (10%) Frame = +1 Query: 7 KP*PSLE----PYPLASPLPDRDTAPEPKPSEQPTTSESGRLAA--VSPSHGARAEQD 162 KP P +E P P P P + PEPKP +P + + R A +SP A E + Sbjct: 123 KPEPKVEAKPEPKPEPKPEPKVEAKPEPKPEPKPAAAPAPRTVASILSPEEIAAREAE 180
>ATBF1_HUMAN (Q15911) Alpha-fetoprotein enhancer-binding protein (AT motif-binding| factor) (AT-binding transcription factor 1) Length = 3703 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPE-PKPSEQPTT 102 +P S P P +P PD+D A E PKP EQ T Sbjct: 3395 QPKASQTPVPPGAPSPDKDPAKESPKPEEQKNT 3427
>TONB_HELPY (O25899) Protein tonB| Length = 285 Score = 31.2 bits (69), Expect = 0.62 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 KP P +P P P P + PEPKP +P Sbjct: 97 KPKPKPKPKPKPKPKPKPEPKPEPKPEPKP 126 Score = 30.8 bits (68), Expect = 0.81 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 K KP P +P P P P+ P+P+P +P E Sbjct: 97 KPKPKPKPKPKPKPKPKPEPKPEPKPEPKPEPKVEE 132 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 K KP P EP P P P + + +P E+P E+ Sbjct: 111 KPKPEPKPEPKPEPKPEPKVEEVKKEEPKEEPKKEEA 147 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 K KP P +P P P P+ P+P+P + E Sbjct: 101 KPKPKPKPKPKPKPEPKPEPKPEPKPEPKVEEVKKE 136
>CSP_PLACB (P08672) Circumsporozoite protein precursor (CS)| Length = 378 Score = 31.2 bits (69), Expect = 0.62 Identities = 23/63 (36%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = -2 Query: 282 PASHLTPLAPAG----LLPCGASAARGSPRDGLGRSAATDDGPRVLLSAGAMRG-RDGGE 118 PA P APAG P G A DG + A D P GA G R GG+ Sbjct: 139 PAGDGAPAAPAGDGAPAAPAGDGAPAAPAGDGAPAAPAGDGAPAAPAGDGAPAGNRAGGQ 198 Query: 117 PTA 109 P A Sbjct: 199 PAA 201
>PTN23_RAT (O88902) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) (His-domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) (Fragment) Length = 1499 Score = 31.2 bits (69), Expect = 0.62 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P L+P P P P P+P+P QP Sbjct: 789 QPPPQLQPQPQPQPQPQPPPQPQPQPQPQP 818 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEP-KPSEQPTTSESGRLAAVSPS 138 P P P +SP P PEP +P E+P+ E+ L S S Sbjct: 1398 PEPTPAPPSSPPPPSSPLPEPPQPEEEPSVPEAPSLGPPSSS 1439 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 797 QPQPQPQPQPPPQPQPQPQPQPQPQPQPQP 826 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 795 QPQPQPQPQPQPPPQPQPQPQPQPQPQPQP 824
>NOL3_MOUSE (Q9D1X0) Nucleolar protein 3| Length = 220 Score = 31.2 bits (69), Expect = 0.62 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 +P P EP P P P+ + PEP+P +P E Sbjct: 180 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPDFQE 213 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 178 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 207 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 176 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 205 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P EP P P P+ + PEP+P +P Sbjct: 173 PEQEPEPEPEPEPEPEPEPEPEPEPEP 199
>TONB_NEIGO (O06432) Protein tonB| Length = 283 Score = 31.2 bits (69), Expect = 0.62 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARA 153 K KP P +P P P+ + P PKP+E+P S + A S + A+A Sbjct: 100 KEKPKPEEKP----KPEPEPEAKPAPKPAEKPAEKPSEKPAEHSGNASAKA 146 Score = 30.8 bits (68), Expect = 0.81 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAE 156 P EP P A P P P KPSE+P SG +A + S E Sbjct: 109 PKPEPEPEAKPAPKPAEKPAEKPSEKP-AEHSGNASAKAGSEQGNGE 154
>REP1_USTMA (Q99109) Repellent protein 1 precursor [Contains: Rep1-1; Rep1-2;| Rep1-3; Rep1-4; Rep1-5; Rep1-6; Rep1-7; Rep1-8; Rep1-9; Rep1-10; Rep1-C] Length = 652 Score = 31.2 bits (69), Expect = 0.62 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 7 KP*PSLEPYPLAS--PLPDRDTAPEPKPSEQPTTSES 111 KP PS +P P S P P PEPKPS++P + S Sbjct: 512 KPQPSDKPEPKPSDKPEPKPSDKPEPKPSDKPEPTPS 548 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGR 117 P +P P P P PEPKPS++P S + Sbjct: 509 PEPKPQPSDKPEPKPSDKPEPKPSDKPEPKPSDK 542 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 KP EP P P P PEP PS +PT Sbjct: 522 KPSDKPEPKPSDKPEPKPSDKPEPTPSPKPT 552 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 16/53 (30%) Frame = +1 Query: 7 KP*PSLEPYPL-ASPLPDRDTA---------------PEPKPSEQPTTSESGR 117 KP PS +P P +P P +DT+ PEPKPS++P S + Sbjct: 482 KPKPSTKPSPSPTTPPPSKDTSKPTTKPEPKPQPSDKPEPKPSDKPEPKPSDK 534
>IRS2_MOUSE (P81122) Insulin receptor substrate 2 (IRS-2) (4PS)| Length = 1321 Score = 31.2 bits (69), Expect = 0.62 Identities = 20/62 (32%), Positives = 28/62 (45%) Frame = -2 Query: 306 LAPTSLSLPASHLTPLAPAGLLPCGASAARGSPRDGLGRSAATDDGPRVLLSAGAMRGRD 127 ++PTS+S P L P A L P GA+ +P G+GR+ + G S D Sbjct: 674 MSPTSVSAPKQILQPRLAAALPPSGAAVP--APPSGVGRTFPVNGGGYKASSPAESSPED 731 Query: 126 GG 121 G Sbjct: 732 SG 733
>MOT8_MOUSE (O70324) Monocarboxylate transporter 8 (MCT 8) (X-linked| PEST-containing transporter) Length = 565 Score = 30.8 bits (68), Expect = 0.81 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 +P P EP P P+P P+P+P QP A P G AE +P Sbjct: 34 EPEPEPEPEPDPEPVPVPPPEPQPEPEPQPLPD-----PAPLPELGFEAEPEP 81 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQP 96 P+ SP+P+ + PEP+P P Sbjct: 25 PVCSPVPEPEPEPEPEPEPDP 45
>Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92)| Length = 279 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P PS PT S Sbjct: 141 PSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPS 172 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P PS P P SP P P P P+ PT S Sbjct: 135 PTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPS 166 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P PS PT S Sbjct: 121 PSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPS 152 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P PS PT S Sbjct: 101 PSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPS 132 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P PS P P SP P P P P+ PT S Sbjct: 95 PTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPS 126 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P PS PT S Sbjct: 131 PSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPS 162 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P PS PT S Sbjct: 91 PSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPS 122 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P P+ PT S Sbjct: 111 PSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPS 142 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P P+ PT S Sbjct: 145 PSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPS 176 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P P+ PT S Sbjct: 115 PSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPS 146 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+ P P SP P P P P+ PT + S Sbjct: 105 PSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPS 138 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+L P P +P P +P P P+ P+ + S Sbjct: 83 PSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPS 116 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P P P P+ PT + S Sbjct: 139 PTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPS 172 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P +P P P+ PT + S Sbjct: 119 PTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPS 152 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P P P P+ PT + S Sbjct: 99 PTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPS 132 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P P P P+ PT + S Sbjct: 129 PTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPS 162 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P P P P+ PT + S Sbjct: 89 PTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPS 122 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P PS P P SP P +P P P+ PT Sbjct: 33 PLPSPTPTPTPSPTPTPTPSPTPTPTPTPT 62 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESG 114 P PS P P +P P P P P+ P+ S G Sbjct: 159 PTPSPTPSPTPTPSPTPSPTPPPSPTPPPSPSPLG 193 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P SP P P P PS P S Sbjct: 151 PSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPS 182 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P P P P+ PT S Sbjct: 149 PTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPS 182 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+ P P +P P +P P PS P S S Sbjct: 157 PTPTPSPTPSPTPTPSPTPSPTPPPSPTPPPSPS 190 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+ P P SP P P P P PT S Sbjct: 155 PSPTPTPSPTPSPTPTPSPTPSPTPPPSPTPPPS 188 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P P+ P P SP P +P P PS P+ Sbjct: 127 PTPTPSPTPTPSPTPSPTPSPTPTPSPTPS 156 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P +P P P P P+ PT S Sbjct: 125 PSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPS 156 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+L P P SP +P P PS P+ + S Sbjct: 73 PTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPS 106 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLA 123 P P+ P P +P P +P P P+ PT + S L+ Sbjct: 51 PSPTPTPTPTPTPTPTPTPSPTPTPALSPTPTPSPTLS 88 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P +P P P+ P+ + S Sbjct: 123 PTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPS 156 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P +P P PS P+ + S Sbjct: 113 PTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPS 146 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P PS P P SP P P PS PT S Sbjct: 67 PTPSPTPTPALSPTPTPSPTLSPTPSPTPTPS 98 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+ P P +P P P P PS PT + S Sbjct: 45 PTPTPTPSPTPTPTPTPTPTPTPTPSPTPTPALS 78 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLA 123 P PS P P SP P P P P+ P+ + + L+ Sbjct: 41 PTPSPTPTPTPSPTPTPTPTPTPTPTPTPSPTPTPALS 78 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P+ P P +P P P P P+ PT + S Sbjct: 37 PTPTPTPSPTPTPTPSPTPTPTPTPTPTPTPTPS 70 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P PS P P +P P P P P+ P+ + S Sbjct: 109 PTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPS 142
>CDN1C_HUMAN (P49918) Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent| kinase inhibitor p57) (p57KIP2) Length = 316 Score = 30.8 bits (68), Expect = 0.81 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P P+ P P+A+P P AP P P+ P + + +A ++ + Q+P Sbjct: 186 PAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEP 237
>CLPB2_SYNPX (Q7U3T3) Chaperone clpB 2| Length = 900 Score = 30.8 bits (68), Expect = 0.81 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 PS+ P P P+P +AP P P P + R+ A P E++P Sbjct: 151 PSVSPAPAPPPVPTAASAPAPTPRSAP----APRVMAPEPEPMVELEREP 196
>PAR1_TRYBB (P08469) Procyclic form-specific polypeptide B1-alpha precursor| (Procyclin B1-alpha) (PARP) Length = 143 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 91 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 120 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 89 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 118 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 87 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 116 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 85 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 114 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 83 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 112 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 81 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 110 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 79 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 108 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 77 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 106 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 75 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 104 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 73 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 102 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 71 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 100 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 69 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 98 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 67 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 96 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 65 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 94 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 63 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 92 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 62 PEPEPEPEPEPEPEPEPEPEPEPEPEPEP 90 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 60 PDPEPEPEPEPEPEPEPEPEPEPEPEPEP 88 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P P EP P P P+ + PEP+P T +S Sbjct: 93 EPEPEPEPEPEPEPEPEPEPEPEPEPEPGAATLKS 127
>TONB_NEIMB (P57004) Protein tonB| Length = 280 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDR--DTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQD 162 K +P P +P P P P+ + P PKP+E+P S + A + A+A+ + Sbjct: 100 KEEPKPEEKPKPEEKPKPEPKPEAKPVPKPAEKPVEKPSEKPAEHPGNASAKADSE 155 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P EP P P P+ PEPKP +P Sbjct: 99 PKEEPKPEEKPKPEEKPKPEPKPEAKP 125 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHG 144 P EP P A P+P P KPSE+P A G Sbjct: 115 PKPEPKPEAKPVPKPAEKPVEKPSEKPAEHPGNASAKADSEQG 157
>TONB_NEIMA (P57003) Protein tonB| Length = 280 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDR--DTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQD 162 K +P P +P P P P+ + P PKP+E+P S + A + A+A+ + Sbjct: 100 KEEPKPEEKPKPEEKPKPEPKPEAKPVPKPAEKPVEKPSEKPAEHPGNASAKADSE 155 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P EP P P P+ PEPKP +P Sbjct: 99 PKEEPKPEEKPKPEEKPKPEPKPEAKP 125 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHG 144 P EP P A P+P P KPSE+P A G Sbjct: 115 PKPEPKPEAKPVPKPAEKPVEKPSEKPAEHPGNASAKADSEQG 157
>PARC_TRYBB (Q06084) Procyclic form-specific polypeptide B-alpha precursor| (Procyclin) (PARP B-alpha) (PSSA-1) Length = 145 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 93 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 122 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 91 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 120 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 89 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 118 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 87 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 116 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 85 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 114 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 83 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 112 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 81 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 110 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 79 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 108 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 77 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 106 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 75 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 104 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 73 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 102 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 71 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 100 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 69 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 98 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 67 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 96 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 65 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 94 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 63 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 92 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 62 PEPEPEPEPEPEPEPEPEPEPEPEPEPEP 90 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 60 PDPEPEPEPEPEPEPEPEPEPEPEPEPEP 88 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P P EP P P P+ + PEP+P T +S Sbjct: 95 EPEPEPEPEPEPEPEPEPEPEPEPEPEPGAATLKS 129
>PARB_TRYBB (P09791) Procyclic form-specific polypeptide A-beta precursor| (Procyclin) (PARP A-beta) Length = 129 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 77 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 106 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 75 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 104 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 73 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 102 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 71 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 100 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 69 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 98 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 67 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 96 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 65 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 94 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 63 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 92 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 62 PEPEPEPEPEPEPEPEPEPEPEPEPEPEP 90 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 60 PDPEPEPEPEPEPEPEPEPEPEPEPEPEP 88 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P P EP P P P+ + PEP+P T +S Sbjct: 79 EPEPEPEPEPEPEPEPEPEPEPEPEPEPGAATLKS 113
>SPTN2_RAT (Q9QWN8) Spectrin beta chain, brain 2 (Spectrin, non-erythroid beta| chain 2) (Beta-III spectrin) (SPNB-3) (Beta SpIII sigma 1) (Spectrin-like protein GTRAP41) Length = 2388 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 194 PSPSRGLPRAALAPQGRRPAGARGVRWEAGRER 292 PS SRGL RA P +P G+ +R + GRER Sbjct: 2343 PSASRGLTRAMTMPPVSQPEGSIVLRSKDGRER 2375
>PROA_TRYBB (P14043) Procyclic form-specific polypeptide precursor (Procyclin)| (PARP) Length = 115 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P EP P P P+ + PEP+P +P Sbjct: 63 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 92 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 62 PEPEPEPEPEPEPEPEPEPEPEPEPEPEP 90 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ + PEP+P +P Sbjct: 60 PDPEPEPEPEPEPEPEPEPEPEPEPEPEP 88 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 +P P EP P P P+ + PEP+P T +S Sbjct: 65 EPEPEPEPEPEPEPEPEPEPEPEPEPEPGAATLKS 99
>YPJA_ECOLI (P52143) Hypothetical outer membrane protein ypjA| Length = 1569 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSP 135 KP P +P P P PD P P+ P+T+ +AA P Sbjct: 1240 KPDPKPDPNPKPDPTPDPTPTPVPEKRITPSTAAVLNMAATLP 1282 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGA 147 P P+ +P P P PD + P+P P PT R ++PS A Sbjct: 1231 PIPNPKPDPKPDPKPDPNPKPDPTPDPTPTPVPEKR---ITPSTAA 1273 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P+ +P P P P D P+P P PT Sbjct: 1227 PNPDPIPNPKPDPKPDPKPDPNPKPDPT 1254 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 KP P P P P PD P PKP P Sbjct: 1226 KPNPDPIPNPKPDPKPDPKPDPNPKPDPTP 1255
>GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E1) (Cellulase E1) (Endocellulase E1) Length = 562 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 +P PS+ P P SP R P P P+ PT Sbjct: 408 QPSPSVSPSPSPSPSASRTPTPTPTPTASPT 438
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +1 Query: 10 P*PSLEPYPLAS--PLPDRDTAPEPKPSEQPTTSESGRLA 123 P P+ P P A+ P P D +PE PS+ PT S + + A Sbjct: 352 PSPADAPSPTAASPPAPPTDESPESAPSDSPTGSANSKSA 391
>M3K1_HUMAN (Q13233) Mitogen-activated protein kinase kinase kinase 1 (EC| 2.7.11.25) (MAPK/ERK kinase kinase 1) (MEK kinase 1) (MEKK 1) (Fragment) Length = 1495 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQ 159 +P LA+ P T+P P+P++ + + AV P HGA + + Sbjct: 57 QPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRR 101
>VGLC_HHV1K (P28986) Glycoprotein C precursor| Length = 511 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGR 117 P P P ++P + P+PKP T ++SGR Sbjct: 84 PPTTPKPTSTPKSPPTSTPDPKPKNNTTPAKSGR 117
>VGLC_HHV11 (P10228) Glycoprotein C precursor| Length = 511 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGR 117 P P P ++P + P+PKP T ++SGR Sbjct: 84 PPTTPKPTSTPKSPPTSTPDPKPKNNTTPAKSGR 117
>MMP9_RABIT (P41246) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 707 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/54 (37%), Positives = 23/54 (42%), Gaps = 7/54 (12%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAA-------VSPSHGARAEQDP 165 EP P A P +PSE PTTS +G +A SPS A DP Sbjct: 458 EPQPTAPPTACPTWPATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDP 511
>MANB_CALSA (P22533) Beta-mannanase/endoglucanase A precursor [Includes: Mannan| endo-1,4-beta-mannosidase A (EC 3.2.1.78) (Beta-mannanase) (Endo-1,4-mannanase); Endo-1,4-beta-glucanase (EC 3.2.1.4) (Cellulase)] Length = 1331 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPS 138 P P++ P P +P P P P P+ PT + L +SPS Sbjct: 745 PTPTVTPTPTVTPTPTVTATPTPTPTPIPTVTP---LPTISPS 784 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P P++ P P +P P P P P+ PT Sbjct: 530 PTPTVTPTPTVTPTPTVTATPTPTPTPTPT 559
>LE756_CAEEL (Q11184) Protein let-756 (Lethal protein 756)| Length = 425 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P PYP PLP R T P+P+ P Sbjct: 337 RPQNPANPYPTYRPLPTRSTVQSPRPAYNP 366
>TEGU_HHV11 (P10220) Large tegument protein (Virion protein UL36)| Length = 3164 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSP 135 +P P +P P P P P+P+P QP + V+P Sbjct: 2944 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQNGHVAP 2986 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQD 162 +P P +P P P P P+P+P QP P+ RA Q+ Sbjct: 2948 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQNGHVAPGEYPAVRFRAPQN 2999 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2942 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2971 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2940 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2969 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2938 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2967 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2936 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2965 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2934 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2963 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2932 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2961 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2930 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2959 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2928 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2957 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2926 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2955 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2924 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2953 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2922 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2951 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2920 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2949 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2918 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2947 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2916 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2945 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2914 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2943 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 2912 QPQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2941 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P +P P P P P+P+P QP Sbjct: 2911 PQPQPQPQPQPQPQPQPQPQPQPQPQPQP 2939
>IF2_PROAC (Q6A7M5) Translation initiation factor IF-2| Length = 964 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P P P P P P + P+P S TS + R + S GA ++Q+P Sbjct: 89 PKPGPGPKPTPGPRPGSSSGPKPGRSSAARTSATPRPGLIK-SSGASSQQEP 139
>VTP3_TTV1V (P19275) Viral protein TPX| Length = 474 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 4 YKP*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 Y+P P + P++SP P P P P+ PT Sbjct: 262 YEPDPQVTVTPISSPSPTPTPTPTPTPTPTPT 293 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPS 138 P P+ P P +P P P P P+ PT + + V+PS Sbjct: 407 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTYDITYVIFDVTPS 449 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPS 138 P P+ P P +P P P P P+ PT + + V+PS Sbjct: 338 PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTYDITYVVFDVTPS 380
>GAG_WMSV (P03330) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 511 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQD 162 PYP A P P A P P + P +S+ AA + S AR+ D Sbjct: 141 PYPAALPPPLAPPAVGPAPGQAPDSSDPEGPAAGTRSRRARSPAD 185
>DRPE_CRAPL (P22242) Desiccation-related protein PCC13-62 precursor| Length = 313 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 158 RTLGPSSVAALRPSPSRGLPRAALAPQGRRPA 253 R LG + AA+RPSP+ +P+ AP G+ P+ Sbjct: 274 RCLGSCTAAAMRPSPAAFIPK---APTGKSPS 302
>GPNMB_MOUSE (Q99P91) Transmembrane glycoprotein NMB precursor (Dendritic| cell-associated transmembrane protein) (DC-HIL) Length = 574 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVS 132 P PS P P SPLP T P PS PT +S L+ +S Sbjct: 332 PPPSTPPSPPPSPLP---TLSTPSPSLMPTGYKSMELSDIS 369
>ETS6_DROME (P29776) DNA-binding protein D-ETS-6| Length = 475 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSP 135 P PLA+P P ++P PS + +S+S R +VSP Sbjct: 110 PLPLATPTPPAVSSPHQAPSPRRNSSDSNR--SVSP 143
>SPKC_SYNY3 (P74745) Serine/threonine-protein kinase C (EC 2.7.11.1)| Length = 535 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/67 (26%), Positives = 27/67 (40%), Gaps = 12/67 (17%) Frame = +1 Query: 1 KYKP*PSLEPYP--------LASPLPDRDTAPEPKPSE----QPTTSESGRLAAVSPSHG 144 K P P++ P P +P+P +P PKP+ PT S + + P Sbjct: 452 KPSPSPTISPQPSPTISIPVTPAPVPKPSPSPTPKPTVPPQISPTPQPSNTVPVIPPPEN 511 Query: 145 ARAEQDP 165 AE +P Sbjct: 512 PSAETEP 518
>GCNL2_HUMAN (Q92830) General control of amino acid synthesis protein 5-like 2| (EC 2.3.1.48) (Histone acetyltransferase GCN5) (hsGCN5) (STAF97) Length = 837 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P+ +P PL SP P P P P+ P Sbjct: 10 PAPAAQPRPLQSPAPAPTPTPAPSPASAP 38 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P P+ P P ++P+P AP P P+ P S +G S GA + DP Sbjct: 26 PTPTPAPSPASAPIPTPTPAPAPAPAAAPAGS-TGTGGPGVGSGGAGSGGDP 76
>SIP1_MOUSE (Q9R0G7) Zinc finger homeobox protein 1b (Smad-interacting protein 1)| Length = 1215 Score = 29.6 bits (65), Expect = 1.8 Identities = 19/66 (28%), Positives = 27/66 (40%) Frame = -2 Query: 315 EAHLAPTSLSLPASHLTPLAPAGLLPCGASAARGSPRDGLGRSAATDDGPRVLLSAGAMR 136 + HL PT L + ++L + P G + PRDG +G G +R Sbjct: 1098 KGHLGPTELLMNRAYLQSITPQGY--SDSEERESMPRDGESEKEHEKEGEE---GYGKLR 1152 Query: 135 GRDGGE 118 RDG E Sbjct: 1153 RRDGDE 1158
>DEOB_DEIRA (Q9RSI9) Phosphopentomutase (EC 5.4.2.7) (Phosphodeoxyribomutase)| Length = 388 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 49 LPDRDTAPEPKPSEQPTTSESGRLAAVSP 135 LP DT+PE P++ T GR+ VSP Sbjct: 52 LPTIDTSPETVPADAEVTGAYGRMREVSP 80
>BSN_RAT (O88778) Bassoon protein| Length = 3937 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 31 YPLASPLPDRDTAPEPKPSEQPTTSESG--RLAAVSPSHGARAEQ 159 +P P P TAP P+P+ P ++G + AA +P G RA Q Sbjct: 3829 HPAGKPQPGPTTAPGPQPAGLPRAEQAGSSKPAAKAPQQG-RAPQ 3872
>VE4_HPV39 (P24831) Probable protein E4| Length = 94 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P + YPL + LP+ T P P P +QP Sbjct: 10 PVTDRYPLLNLLPNYQTPPRPIPPQQP 36
>VA05_VACCC (P20983) Protein A5 (Protein A4)| Length = 281 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 25 EPYPLASPLP---DRDTAPEPKPSEQPTTS 105 +P P A+P P TAP PKP +Q TS Sbjct: 81 QPVPTATPAPILLPSSTAPTPKPRQQTNTS 110
>CHEB2_CAUCR (Q9AAK0) Chemotaxis response regulator protein-glutamate| methylesterase of group 2 operon (EC 3.1.1.61) Length = 347 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = +2 Query: 95 QPPAKAVGXXXXXXXXXXXXXRTLGPSSVAALRPSPSRGLPRAALAPQGRRPAG 256 +P A +G R LG A RP+P + PR LAP PAG Sbjct: 104 KPSANKLGGADLYRKDLIEKVRHLG---ARAARPAPPQAAPRPTLAPPSSDPAG 154
>SYN1_MOUSE (O88935) Synapsin-1 (Synapsin I)| Length = 706 Score = 25.0 bits (53), Expect(2) = 2.4 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 167 GPSSVAALRPSPSRGLPRAALAPQGRRPAGARG 265 GP + A RP S R A APQ R A G Sbjct: 539 GPGAPPAARPPASPSPQRQAGAPQATRQASISG 571 Score = 22.7 bits (47), Expect(2) = 2.4 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQ-----PTTSESGR 117 P SPLP R +P P + P T GR Sbjct: 499 PAGSPLPQRLPSPTAAPQQSASQATPVTQGQGR 531
>ADRB3_MOUSE (P25962) Beta-3 adrenergic receptor (Beta-3 adrenoceptor) (Beta-3| adrenoreceptor) Length = 400 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 315 EAHLAPTSLSLPASHLTPLAPAGLLPCGASAARGSP 208 E+ +P+ PA+ TP AP G+ PCG AR P Sbjct: 246 ESPPSPSRSPSPATGGTPAAPDGVPPCGRRPARLLP 281
>TONB_HELPJ (Q9ZJP4) Protein tonB| Length = 280 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPK--------PSEQPTTSES 111 K KP P +P P P P+ PEPK P E+P E+ Sbjct: 98 KPKPKPKPKPKPKPKPKPEPKPKPEPKVEEPKKEEPKEEPKKEEA 142 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 P +P P P P PEPKP +P E Sbjct: 97 PKPKPKPKPKPKPKPKPKPEPKPKPEPKVEE 127 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPS-EQPTTSE 108 K KP P +P P P P + P+P+P E+P E Sbjct: 96 KPKPKPKPKPKPKPKPKPKPEPKPKPEPKVEEPKKEE 132
>RAPH1_HUMAN (Q70E73) Ras-associated and pleckstrin homology domains-containing| protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein) Length = 1302 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGA 147 P P P P ASP PD+ +P K S+ T+S G+ +P + Sbjct: 988 PAPPPPPPPTASPTPDKSGSPGKKTSK--TSSPGGKKPPPTPQRNS 1031
>GP10_DICDI (Q06885) Glycoprotein gp100 precursor (P29F8)| Length = 544 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 P P+ P P ++P P T P P + +PT S Sbjct: 163 PTPTSTPTPTSTPTPTSQTIPPPTTTPKPTKS 194 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P P+ P P + +P T P+P S +PT Sbjct: 169 PTPTSTPTPTSQTIPPPTTTPKPTKSSKPT 198
>YMCR_STRLA (P43458) Putative HTH-type transcriptional regulator in mcrB| 3'region Length = 281 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 46 PLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 PLP R TAPEP S ++ +VSP + R + P Sbjct: 22 PLPWRTTAPEPGAPPHEHLSARRKIHSVSPEYEERTSRLP 61
>MAST1_HUMAN (Q9Y2H9) Microtubule-associated serine/threonine-protein kinase 1 (EC| 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase) Length = 1570 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 306 LAPTSLSLPASHLTPLAPAGLLPCGASAARG 214 LAP S P+S +TP+ PA LL G G Sbjct: 1512 LAPAKCSAPSSAVTPVPPASLLGSGTKPQVG 1542
>CLN5_HUMAN (O75503) Ceroid-lipofuscinosis neuronal protein 5 (Protein CLN5)| Length = 407 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 258 APAGLLPCGASAARGSPRDG---LGRSAATDDGPRVLLSAGAMRGR 130 AP LLP + A+RGS G + + T G + AGA RGR Sbjct: 27 APRMLLPPASQASRGSGSTGCSLMAQEVDTAQGAEMRRGAGAARGR 72
>ACN1_CAEEL (Q18581) Inactive angiotensin-converting enzyme-related protein| precursor (ACE-like non-metallopeptidase protein 1) Length = 906 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P+ PEP P+ +P Sbjct: 63 PVPEPEPKPEPEPEPEPKPEPEPSPTPEP 91 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEPKPSEQPT 99 P P P P+ + PEPKP +P+ Sbjct: 63 PVPEPEPKPEPEPEPEPKPEPEPS 86 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPS 87 +P P EP P P P+ PEP+P+ Sbjct: 68 EPKPEPEPEPEPKPEPEPSPTPEPEPA 94
>MK07_HUMAN (Q13164) Mitogen-activated protein kinase 7 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 5) (ERK-5) (ERK4) (BMK1 kinase) Length = 815 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P+ P P +P P + T+P P P QPT Sbjct: 586 PAPAPAPTPTPTPVQPTSPPPGPLAQPT 613
>AURB_CHLAU (P27197) Auracyanin B precursor (Ac-B) [Contains: Auracyanin B-1;| Auracyanin B-2] Length = 235 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEPKPSEQPTTSESGRLA 123 P P A+P P AP P+ QPTT+ + + A Sbjct: 66 PRPTATPRPTAAPAPTQPPAAQPTTAPATQAA 97
>SALL3_HUMAN (Q9BXA9) Sal-like protein 3 (Zinc finger protein SALL3) (hSALL3)| Length = 1300 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +1 Query: 43 SPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 +P P + PEP P+ P+ A + + GA E P Sbjct: 86 APAPPHEDFPEPSPASSPSERAESEAAEEAGAEGAEGEARP 126
>CSP_PLABA (P23093) Circumsporozoite protein precursor (CS)| Length = 347 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 215 QPQPRPQPQPQPQPQPQPQPQPQPRPQPQP 244 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESG 114 P P P P P P P+P+P QP G Sbjct: 214 PQPQPRPQPQPQPQPQPQPQPQPQPRPQPQPQPGG 248 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P P+P QP Sbjct: 217 QPRPQPQPQPQPQPQPQPQPQPRPQPQPQP 246
>GCNL2_MOUSE (Q9JHD2) General control of amino acid synthesis protein 5-like 2| (EC 2.3.1.48) (Histone acetyltransferase GCN5) (mmGCN5) Length = 830 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P P+ +P PL SP P + P P P+ T Sbjct: 10 PVPAAQPRPLHSPAPAPTSTPAPSPASAST 39
>CSP_PLABE (P06915) Circumsporozoite protein precursor (CS)| Length = 339 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P+P+P QP Sbjct: 207 QPQPRPQPQPQPQPQPQPQPQPQPRPQPQP 236 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESG 114 P P P P P P P+P+P QP G Sbjct: 206 PQPQPRPQPQPQPQPQPQPQPQPQPRPQPQPQPGG 240 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P +P P P P P P+P QP Sbjct: 209 QPRPQPQPQPQPQPQPQPQPQPRPQPQPQP 238
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 KP P P P SP P P+PKP P Sbjct: 94 KPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 123 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAV 129 KP P P P +P P AP PKP+ P E+ + AV Sbjct: 167 KPVPPHGPPPKPAPAPT--PAPSPKPAPSPPKPENKTIPAV 205 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKP 84 KP P P P+ P P + AP PKP Sbjct: 143 KPAPPPAPKPVPCPSPPKPPAPTPKP 168 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSP 135 P P P P P+P P PKP+ PT + S + A P Sbjct: 156 PSPPKPPAPTPKPVPPH--GPPPKPAPAPTPAPSPKPAPSPP 195 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 KP P+ P P SP P P P P+ PT Sbjct: 98 KPPPAPSPSPCPSPPPKPQPKPVPPPACPPT 128
>SYN3_MOUSE (Q8JZP2) Synapsin-3 (Synapsin III)| Length = 579 Score = 23.9 bits (50), Expect(2) = 3.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 167 GPSSVAALRPSPSRGLPRAALAPQGRRP 250 GP + +P SR + L+PQG++P Sbjct: 440 GPRQAQSPQPPRSRSPSQQRLSPQGQQP 467 Score = 23.5 bits (49), Expect(2) = 3.2 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 46 PLPDRDTAPEPKPSEQPTTSESGRLAA-----VSPSHGARAEQDP 165 P P R P+ KP++ P + G L P G R Q P Sbjct: 403 PSPLRPWGPQTKPAKSPGQGQLGPLLGQPQPRPPPQGGPRQAQSP 447
>MYCB2_MOUSE (Q7TPH6) Probable ubiquitin ligase protein MYCBP2 (EC 6.3.2.-) (Myc| binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4711 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKP-SEQPTTSESGRLAAVSP 135 PL PL R T+P+PKP + P S A SP Sbjct: 2921 PLTEPLRGRSTSPKPKPVPKDPKDSPGSENRAPSP 2955
>ABP1_SACEX (P38479) Actin-binding protein| Length = 617 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +1 Query: 40 ASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 A LP R+ APEP+P EQP E A +PS +R P Sbjct: 504 APSLPSRNAAPEPEP-EQPQEEEEEE-EAPAPSLPSRGSVPP 543 Score = 27.7 bits (60), Expect = 6.9 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEP-----KPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P+ E P PLP R+T PEP + E+ E A PS A E +P Sbjct: 465 PARESAP-QQPLPPRNTEPEPVEEGEEEEEEEEEEEEEAPAPSLPSRNAAPEPEP 518
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P L+P P P P +P+P QP Sbjct: 170 QPQPQLQPQPQPQPQPQPQPQSQPQPQPQP 199 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P +P P P P P+P+P QP Sbjct: 177 PQPQPQPQPQPQPQSQPQPQPQPKPQP 203
>IF2_CORJK (Q4JV51) Translation initiation factor IF-2| Length = 922 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRL--AAVSPSHGARA 153 KP P P A P P P PKP +P G A P G RA Sbjct: 118 KPGEKPAPKPGAKPAPKTAAKPTPKPGAKPGPKPGGAKPGAKPGPKPGGRA 168
>EMD_MOUSE (O08579) Emerin| Length = 259 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 161 TLGPSSVAALRPSPSRGLPRAALAPQGRRPAGARG 265 T SSV++ SPS L R A+ P+ + PA A G Sbjct: 185 TSSTSSVSSSSSSPSSWLTRRAIRPEKQAPAAALG 219
>OXAA_NITEU (P59810) Inner membrane protein oxaA| Length = 614 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 52 PDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P +DT PEP S+Q +SE+ A SP+ + Q P Sbjct: 564 PSKDT-PEPPVSKQVNSSENPETTANSPADSPKQPQTP 600
>V50K_BYDVP (P09516) 50 kDa protein (ORF 4)| Length = 450 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 +P P+ EP P P P PEP P+ P Sbjct: 7 EPKPAPEPTPTPQPTPAPQPTPEPTPAPVP 36 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPT 99 EP P P P P P+P+ +PT Sbjct: 7 EPKPAPEPTPTPQPTPAPQPTPEPT 31
>PEXLP_TOBAC (Q03211) Pistil-specific extensin-like protein precursor (PELP)| Length = 426 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P P P SP P + P P P + P+ S + + P RA++ P Sbjct: 179 PPPPPPPVKAPSPSPAKQPPPPPPPVKAPSPSPATQPPTKQPPPPPRAKKSP 230
>MMP9_BOVIN (P52176) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 712 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAA 126 EP P A P P +PSE PTT +G AA Sbjct: 463 EPQPTAPPTVCVTGPPTARPSEGPTTGPTGPPAA 496
>MB11_ARATH (Q9SAV1) Myrosinase-binding protein-like At1g52030 (MBP)| Length = 642 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHG 144 P P+ P P SP P P P P+ P + ++ A+ + G Sbjct: 301 PAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPPNKVEALGGNGG 345
>CASZ1_HUMAN (Q86V15) Castor homolog 1 zinc finger protein (Castor-related| protein) Length = 1044 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTS 105 K P PSL P PLAS +P +AP P P + S Sbjct: 266 KVPPTPSLAPAPLAS-VPSAPSAPGPGPEPPASLS 299
>PER1_MOUSE (O35973) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (mPER) (M-Rigui) Length = 1291 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQ 159 P L P P SP P AP+P P G AV H + EQ Sbjct: 748 PGLAPGPAPSPAPSPTVAPDPTPDAYRPV---GLTKAVLSLHTQKEEQ 792
>EGF_MOUSE (P01132) Pro-epidermal growth factor precursor (EGF) [Contains:| Epidermal growth factor] Length = 1217 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 180 TDDGPRVLLSAGAMRGRDG 124 T DGPR + AG++ GRDG Sbjct: 421 TSDGPRCICPAGSVLGRDG 439
>PEP_DROME (P41073) Zinc finger protein on ecdysone puffs| Length = 716 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 P EP P+ +P P P P++ PT + + A + A+ P Sbjct: 636 PEPEPAPVQTPAPAEPAPPAKTPAKTPTKAAAPAAVASPAAAATSADASP 685
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 9/43 (20%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDR---------DTAPEPKPSEQPTTSES 111 P P+ P P+ +P P +++PE PS+ PT+SE+ Sbjct: 351 PTPAKSPSPVEAPSPTAASPPAPPVDESSPEGAPSDSPTSSEN 393
>PER1_RAT (Q8CHI5) Period circadian protein 1 (rPER1) (Fragment)| Length = 1244 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQ 159 P L P P SP P AP+P P G AV H + EQ Sbjct: 747 PGLAPGPAPSPAPSPTVAPDPAPDAYRPV---GLTKAVLSLHTQKEEQ 791
>GRI22_VITVI (Q9M4H4) Ripening-related protein grip22 precursor| Length = 220 Score = 28.1 bits (61), Expect = 5.3 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = -2 Query: 267 TPLAPAGLLPCGASAARGS-PRDGLGRSAA-TDDGPRVLLSAGAMRGRDGGEPTAFAXXX 94 +P P+ P G A +G P++ S T P VL + +G DGG P+A Sbjct: 71 SPPPPSTCQPSGTLACKGGKPKNTYTCSPPITSSTPAVLTNNNFEKGGDGGGPSACDNKY 130 Query: 93 XXXXXXXXXGVSVWEGGGER 34 + W GG R Sbjct: 131 HDNSERIVALSTGWYNGGSR 150
>B3A3_HUMAN (P48751) Anion exchange protein 3 (Neuronal band 3-like protein)| (Solute carrier family 4 member 3) (Cardiac/brain band 3-like protein) (CAE3/BAE3) Length = 1232 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 49 LPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQ 159 LP R +P PS P T +S + ++ SPS ARA + Sbjct: 178 LPGRAAVTKPLPSVGPHTDKSPQHSSSSPSPRARASR 214
>IASPP_HUMAN (Q8WUF5) RelA-associated inhibitor (Inhibitor of ASPP protein)| (Protein iASPP) (PPP1R13B-like protein) (NFkB-interacting protein 1) Length = 828 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPE--PKPSEQPTT 102 P P L+P P P P P+ P+P QP T Sbjct: 402 PPPKLQPQPQPQPQPQSQPQPQLPPQPQTQPQT 434
>GDA3_WHEAT (P04723) Alpha/beta-gliadin A-III precursor (Prolamin)| Length = 282 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPS----EQPTTSESGR 117 +P P PYP P P + P+P+P +QP + + + Sbjct: 80 QPFPPQLPYPQTQPFPPQQPYPQPQPQYPQPQQPISQQQAQ 120 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAP--EPKPSEQP 96 +P PS +PYP P P + P +P P +QP Sbjct: 68 QPFPSQQPYPQPQPFPPQLPYPQTQPFPPQQP 99 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKP 84 P +PYP P P + P+P+P Sbjct: 59 PPQQPYPHQQPFPSQQPYPQPQP 81
>Y801_DEIRA (Q9RW68) Putative carotenoid cyclase DR0801| Length = 410 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -2 Query: 258 APAGLLPCGASAARGSPRDGLGRSAATDDGPRV--LLSAGAMRGRD 127 AP G+L GA+A R P G + A D P V ++ +G+D Sbjct: 259 APGGVLAYGAAAGRVHPVSGFQVAGALSDAPGVATAIATALCQGKD 304
>IF2_NOCFA (Q5YSC6) Translation initiation factor IF-2| Length = 969 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 191 RPSPSRGLPRAALAPQGRRPAGARG 265 RP P +G PR P G RPA A+G Sbjct: 213 RPGPGQGAPRPGATP-GPRPAAAQG 236
>PER1_HUMAN (O15534) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (hPER) Length = 1290 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQ 159 P L P P SP P AP+P P G AV H + EQ Sbjct: 748 PGLAPGPAPSPAPSPTVAPDPAPDAYRPV---GLTKAVLSLHTQKEEQ 792
>IF2_THEFY (Q47RV1) Translation initiation factor IF-2| Length = 955 Score = 28.1 bits (61), Expect = 5.3 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 11/64 (17%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEP-----KPSEQPTTS------ESGRLAAVSPSHGARA 153 KP P L+P P P P P P K +QP+ + ESG+ P G R Sbjct: 99 KPGPGLKPGPRPVPKPGPRPGPRPEGGAGKAGQQPSGAQGPARPESGKTPRPVPKPGPRP 158 Query: 154 EQDP 165 +P Sbjct: 159 GNNP 162 Score = 27.3 bits (59), Expect = 9.0 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 18/81 (22%) Frame = -2 Query: 300 PTSLSLPASHLTPLAPA------------------GLLPCGASAARGSPRDGLGRSAATD 175 P+ +++PAS TP A G P G A G+PR G G Sbjct: 249 PSPMNMPASRPTPPGGARPSTSSRSGGGRGRGGGGGAGPRGGGAGGGAPRTGFGGRPGGG 308 Query: 174 DGPRVLLSAGAMRGRDGGEPT 112 G +AGA GR GG P+ Sbjct: 309 RGRGG--TAGAF-GRPGGRPS 326
>MMP9_CANFA (O18733) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 704 Score = 28.1 bits (61), Expect = 5.3 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 12/66 (18%) Frame = +1 Query: 4 YKP*PSLEPYPLASPLPDRDTA-----PEPKPSEQPTTSESGRLAA-------VSPSHGA 147 Y P P EP P +P T P +PSE+PT +G AA PS Sbjct: 443 YGPRPEPEPQPPTAPPTAPPTVCATGPPTTRPSERPTAGPTGPPAAGPTGPPTAGPSEAP 502 Query: 148 RAEQDP 165 DP Sbjct: 503 TVPVDP 508
>CAC1D_DROME (Q24270) Voltage-dependent calcium channel type D alpha-1 subunit| (DmCa1D) Length = 2516 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 309 HLAPT-SLSLPASHLTPLAPAGLLPCGASAARG 214 H +PT +L +PA+ LT A AG P GA A G Sbjct: 70 HRSPTITLPVPANPLTTSASAGSSPTGAGLAAG 102
>PFPI_PYRHO (O59413) Intracellular protease 1 (EC 3.2.-.-) (Intracellular| protease I) Length = 166 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 171 GPRVLLSAGAMRGRDG 124 GP++L+SAG +RGR G Sbjct: 102 GPQILISAGVLRGRKG 117
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 4 YKP*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSH 141 Y P P ++P P SP P P P P + + P+H Sbjct: 192 YSPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTH 237
>EFHD1_HUMAN (Q9BUP0) EF-hand domain-containing protein 1 (Swiprosin-2)| Length = 239 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQPTTSESGRLAA 126 PL +P P+ PEP P+ PT S L+A Sbjct: 28 PLGAPAPEPKPEPEP-PARAPTASADAELSA 57
>ZN219_HUMAN (Q9P2Y4) Zinc finger protein 219| Length = 722 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSP 135 P +P P P P+ + P+P+P +P + A +P Sbjct: 226 PPPQPQPQPPPQPEPRSVPQPEPEPEPEREATPTPAPAAP 265 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEP--KPSEQPTTSESGRLAAVSPSHGA 147 P P P R +AP+ KPS QP T G + PS GA Sbjct: 560 PPPEPPPPSQRGSAPQSGAKPSPQPATWVEGASSPRPPSSGA 601
>VA05_VACCV (P29191) Protein A5 (Protein A4)| Length = 281 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +1 Query: 25 EPYPLASPLP---DRDTAPEPKPSEQPTTS 105 +P P A+P P T P PKP +Q TS Sbjct: 81 QPVPTATPAPILLPSSTVPTPKPRQQTNTS 110
>LYOX_MOUSE (P28301) Protein-lysine 6-oxidase precursor (EC 1.4.3.13) (Lysyl| oxidase) (RAS excision protein) Length = 411 Score = 27.7 bits (60), Expect = 6.9 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 7/72 (9%) Frame = +2 Query: 68 RRNPNHPSNQPPAKAVGXXXX------XXXXXXXXXRTLGPSSVAALRPSP-SRGLPRAA 226 RR+P+ + +P A RT PS VAA RP P +R +A Sbjct: 63 RRDPSATARRPDGDAASQPRTPILLLRDNRTASTRARTPSPSGVAAGRPRPAARHWFQAG 122 Query: 227 LAPQGRRPAGAR 262 +P G R +R Sbjct: 123 FSPSGARDGASR 134
>GUNA_CALSA (P22534) Endoglucanase A precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase A) (Cellulase A) Length = 1742 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPT 99 P P++ P P +P P P P P+ PT Sbjct: 1069 PTPTVTPTPTPAPTPTATPTPTPTPTVTPT 1098
>FZD8_MOUSE (Q61091) Frizzled 8 precursor (Frizzled-8) (Fz-8) (mFz8)| Length = 685 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 19/57 (33%) Frame = +1 Query: 40 ASPLPDRDTAPEPKPSEQPTTSE-------------------SGRLAAVSPSHGARA 153 A+P P R P P P EQP + SG AA PS G +A Sbjct: 159 AAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKA 215
>BAG3_MOUSE (Q9JLV1) BAG family molecular chaperone regulator 3 (BCL-2-binding| athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) Length = 577 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSE 108 P PS P P A P P ++ A E K + P +E Sbjct: 377 PCPSPSPAPSAVPSPPKNVAAEQKAAPSPAPAE 409
>ODO2_MYCTU (P65633) Dihydrolipoyllysine-residue succinyltransferase component| of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) Length = 553 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESG 114 P P+ +P P +P P + AP P P+ QP + G Sbjct: 207 PKPAPKPVPEPAPTPKAEPAPSP-PAAQPAGAAEG 240
>ODO2_MYCBO (P65634) Dihydrolipoyllysine-residue succinyltransferase component| of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) Length = 553 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESG 114 P P+ +P P +P P + AP P P+ QP + G Sbjct: 207 PKPAPKPVPEPAPTPKAEPAPSP-PAAQPAGAAEG 240
>MOT8_HUMAN (P36021) Monocarboxylate transporter 8 (MCT 8) (X-linked| PEST-containing transporter) (MCT 7) Length = 613 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P PEP+P QP Sbjct: 103 PEPESEPEPEPEPEPVPVPPPEPQPEPQP 131
>SASH1_HUMAN (O94885) SAM and SH3 domain-containing protein 1 (Proline-glutamate| repeat-containing protein) Length = 1247 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPSEQPTTSES 111 P EP P P P+ PEP+P TSE+ Sbjct: 9 PGPEPEPEPEPEPEPAPEPEPEPKPGAGTSEA 40
>IF2_PSEF5 (Q4KIF6) Translation initiation factor IF-2| Length = 838 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 25 EPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQD 162 +P P+A P+ + AP P P +P + +A +P+ AR + + Sbjct: 137 QPAPVAEPVAAQAAAPAPAPVVEPV--QEAPVATAAPAADARKKDE 180
>YFAL_ECOLI (P45508) Hypothetical protein yfaL precursor| Length = 1250 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 16 PSLEPYPLASPLPDRDTAPEPKPS 87 P +P P P PD D P+P+P+ Sbjct: 924 PDPDPTPDPDPTPDPDPTPDPEPT 947 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P P P +P PD PEP P+ QP Sbjct: 924 PDPDPTPDPDPTPDPDPTPDPEPTPAYQP 952
>VST2_HEVPA (P33426) Structural protein 2 precursor| Length = 660 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSH 141 PL S D+ P +PTT+ + L AV+P+H Sbjct: 82 PLGSAWRDQAQRPAAASRRRPTTAGAAPLTAVAPAH 117
>CWC27_NEUCR (Q7SBX8) Peptidyl-prolyl isomerase cwc-27 (EC 5.2.1.8)| Length = 541 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQPTTSES 111 P+A+ +P R+ PEPKP ++ S S Sbjct: 285 PVANDVPKREEKPEPKPVKESRRSPS 310
>REEP1_MOUSE (Q8BGH4) Receptor expression-enhancing protein 1| Length = 201 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 234 GASAARGSPRDGLGRSAATDDGPRVLLSAGAMRGRDG 124 GA A G P G GRS+ P++ SA G G Sbjct: 163 GAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSG 199
>PFPI_PYRAB (Q9V1F8) Intracellular protease 1 (EC 3.2.-.-) (Intracellular| protease I) Length = 166 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 171 GPRVLLSAGAMRGRDG 124 GP++L+SAG +RGR G Sbjct: 102 GPQILISAGVLRGRRG 117
>HR4_DROME (Q9W539) Hormone receptor 4 (dHR4)| Length = 1518 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARA 153 P P P P+A PLP P S T S + +AAV+ + GA A Sbjct: 71 PLPLALPLPMALPLPMSLPLPLTAASSAVTVSLAAVVAAVAETGGAGA 118
>DNAA_PHOPR (Q6LW50) Chromosomal replication initiator protein dnaA| Length = 474 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAP----EPKPSEQPTTSESGRLAAVSPSH 141 P +L P PL + +D AP EP PS S+SG + V+P H Sbjct: 96 PAVTLAPRPLPATRILQDDAPSRSWEPAPSPVQPESKSGYRSNVNPKH 143
>FUZ7_USTMA (Q99078) Dual specificity protein kinase FUZ7 (EC 2.7.12.2)| Length = 435 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQPTTSES---GRLAAVSP 135 PLASP+ T P KP E S + G+ +AV+P Sbjct: 25 PLASPVDASATTPSHKPGEGSAASNASTIGKSSAVTP 61
>DCT1A_XENLA (Q8JJ48) Dapper 1-A (Frodo)| Length = 818 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 273 HLTPLAPAGLLPCGASAARGSPRDGLGRSA 184 ++TP APA L +S GSPR+ SA Sbjct: 455 NVTPNAPANLPNASSSVCNGSPRESTQNSA 484
>UVRA_DEIRA (Q46577) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 1016 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = -2 Query: 267 TPLAPAGLLPCGASAARGSPRDGLGRSAATDDGPRVLLSAGAMRGRDGGEPTAFA 103 TP P CG + SP + R A R +L A A+RGR G FA Sbjct: 118 TPYCPI----CGRKIEKQSPSEVTDRLLAGFPDKRAILLAPAVRGRKGEYKKLFA 168
>MMP9_MOUSE (P41245) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 730 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P +SP P AP P P+ PT S Sbjct: 493 PGPTSSPSPGPTGAPSPGPTAAPTAGSS 520
>LTBP4_MOUSE (Q8K4G1) Latent transforming growth factor beta-binding protein 4| precursor (LTBP-4) Length = 1666 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 P P EP P P P ++ P P+P +P Sbjct: 515 PGPQPEPRPRPEPRPRPESRPRPEPRPRP 543
>DACT1_XENTR (Q66KC9) Dapper 1| Length = 824 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 273 HLTPLAPAGLLPCGASAARGSPRDGLGRSA 184 ++TP AP L +SA GSPR+ SA Sbjct: 461 NVTPNAPTNLSNASSSACNGSPRESTQMSA 490
>SYY_MYCFO (Q9EUU8) Tyrosyl-tRNA synthetase (EC 6.1.1.1) (Tyrosine--tRNA| ligase) (TyrRS) Length = 428 Score = 27.3 bits (59), Expect = 9.0 Identities = 26/67 (38%), Positives = 32/67 (47%), Gaps = 10/67 (14%) Frame = -2 Query: 300 PTSLSLPASHLTPLAP------AG----LLPCGASAARGSPRDGLGRSAATDDGPRVLLS 151 PT+ SL A HL PL AG +L GA+ G PRD R+ T D V Sbjct: 41 PTAPSLHAGHLVPLLTLRRFQRAGHRPIVLAGGATGMIGDPRDTGERTLNTAD--TVADW 98 Query: 150 AGAMRGR 130 AG +RG+ Sbjct: 99 AGRIRGQ 105
>GNDS_MOUSE (Q03385) Ral guanine nucleotide dissociation stimulator (RalGEF)| (RalGDS) Length = 852 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRL-AAVSPS 138 P P L P+ +P P+ + PEP +P+ + + L AVS S Sbjct: 244 PVPVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQS 287
>PHLA1_MOUSE (Q62392) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Proline- and glutamine-rich protein) (PQR protein) Length = 261 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 7 KP*PSLEPYPLASPLPDRDTAPEPKPSE 90 +P P ++P P P P P+P+P + Sbjct: 174 QPQPQIQPQPQPQPQPQPQPQPQPQPQQ 201
>GPA1_TRIVA (Q86D96) Guanine nucleotide-binding protein alpha-1 subunit (G| alpha-1) (GTP-binding protein alpha subunit 1) Length = 402 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 1 KYKP*PSLEPYPLASPLPDRDTAPEPKPSEQP 96 K +P P EP P P + AP P P+ +P Sbjct: 32 KPEPQPQPEPQPQPEPPKPAEPAPAPAPAPEP 63
>GNDS_HUMAN (Q12967) Ral guanine nucleotide dissociation stimulator (RalGEF)| (RalGDS) Length = 914 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +1 Query: 7 KP*PSLEPY--PLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSHGARAEQDP 165 KP P LE P +P P APEP+P+ P G V+P+ +Q P Sbjct: 268 KPTPELELALTPARAPSPVPAPAPEPEPAPTPA---PGSELEVAPAPAPELQQAP 319
>JIP3_HUMAN (Q9UPT6) C-jun-amino-terminal kinase-interacting protein 3| (JNK-interacting protein 3) (JIP-3) (JNK MAP kinase scaffold protein 3) (Mitogen-activated protein kinase 8-interacting protein 3) Length = 1334 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRD---TAPEPKPSEQPTTSES 111 P PS P P + P+ D T PEP+PS PT + S Sbjct: 927 PTPSSGPQPGSENGPEPDSSSTRPEPEPSGDPTGAGS 963
>ARI5B_HUMAN (Q14865) AT-rich interactive domain-containing protein 5B (ARID| domain-containing protein 5B) (Mrf1-like) (Modulator recognition factor 2) (MRF-2) Length = 1188 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 28 PYPLASPLPDRDTAPEPKPSEQPTTSES 111 P P A P++D+A P S+QP TS S Sbjct: 541 PLPSAPLAPEKDSALVPGASKQPLTSPS 568
>ZN358_HUMAN (Q9NW07) Zinc finger protein 358| Length = 481 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 10 P*PSLEPYPLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPS 138 P P L+P P SP PD +P+P P P R VSP+ Sbjct: 421 PSPDLDPVP--SPDPDPVPSPDPNPVSCPDPCSPTR-GTVSPA 460
>VST2_HEVMY (Q04611) Structural protein 2 precursor| Length = 660 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSH 141 PL S D+ P +PTT+ + L AV+P+H Sbjct: 82 PLGSAWRDQAQRPAVASRRRPTTAGAAPLTAVAPAH 117
>VST2_HEVBU (P29326) Structural protein 2 precursor| Length = 660 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 34 PLASPLPDRDTAPEPKPSEQPTTSESGRLAAVSPSH 141 PL S D+ P +PTT+ + L AV+P+H Sbjct: 82 PLGSAWRDQAQRPAVASRRRPTTAGAAPLTAVAPAH 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.133 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,969,647 Number of Sequences: 219361 Number of extensions: 550411 Number of successful extensions: 4594 Number of sequences better than 10.0: 150 Number of HSP's better than 10.0 without gapping: 3006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4195 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)