| Clone Name | bastl33e01 |
|---|---|
| Clone Library Name | barley_pub |
>ZN645_MACFA (Q4R361) Zinc finger protein 645| Length = 422 Score = 37.7 bits (86), Expect = 0.011 Identities = 33/112 (29%), Positives = 46/112 (41%), Gaps = 11/112 (9%) Frame = +1 Query: 37 QVPPQPRTFSRPGP--WRSAGA----GGRVLVTHTHTQS-----LPNSDVKFAFFALTPT 183 QVPP + S P P W + G ++V H S P+ + + P Sbjct: 206 QVPPPELSPSPPFPIQWETVSVFTRKHGNLIVDHIQNNSDSGAKKPSPPDYYPEYQSQPV 265 Query: 184 LSLLYSRLAFVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLAS 339 +S HI + +H PPSPSS + P+P+ P G TPNL S Sbjct: 266 VSS--------PCHIMPQKQHYAPPPSPSSPVNYPMPYPPQDVG--TPNLVS 307
>MUCDL_MOUSE (Q8VHF2) Mucin and cadherin-like protein precursor| (Mu-protocadherin) Length = 831 Score = 34.3 bits (77), Expect = 0.13 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 1/106 (0%) Frame = +1 Query: 25 GTT*QVPPQPRTFSRPGPWRSAGAGGRVLVTHTHTQSL-PNSDVKFAFFALTPTLSLLYS 201 G+ PP T P P S G L T T Q+ P D T + S Sbjct: 497 GSVGPFPPGGTTLRPPTPASSIPGGSPTLGTSTSPQTTTPGGDSAQTPKPGTSHPTAPTS 556 Query: 202 RLAFVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLAS 339 R + + + RS+ + P +SQ PIP +S PATP+ +S Sbjct: 557 RTSTSLMTTSSRSDSTQTPKPGTSQPMVPIPGASTSSQPATPSGSS 602
>STIM2_HUMAN (Q9P246) Stromal interaction molecule 2 precursor| Length = 746 Score = 32.3 bits (72), Expect = 0.48 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 235 RSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLASLAPN 351 RS +P SP QR+ PH PH S P P+ P+ Sbjct: 514 RSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPH 552
>SORC1_HUMAN (Q8WY21) VPS10 domain-containing receptor SorCS1 precursor (hSorCS)| Length = 1168 Score = 31.6 bits (70), Expect = 0.81 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 5/86 (5%) Frame = +1 Query: 97 GGRVLVTHTHTQSLPNSDVK--FAFFALTPTLSLLYSRLAFVSVHITDRSEHRKLPPSPS 270 G RVLV H + P D+ + A+ LS+++ LA ++ R PPSPS Sbjct: 1076 GVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPS 1135 Query: 271 SQ---RSAPIPHTPHTSGPATPNLAS 339 +Q S + H + P+TP S Sbjct: 1136 TQPGDSSLRLQRARHATPPSTPKRGS 1161
>WSP1_SCHPO (O36027) Wiskott-Aldrich syndrome homolog protein 1| Length = 574 Score = 28.9 bits (63), Expect(2) = 1.2 Identities = 29/103 (28%), Positives = 43/103 (41%) Frame = +1 Query: 40 VPPQPRTFSRPGPWRSAGAGGRVLVTHTHTQSLPNSDVKFAFFALTPTLSLLYSRLAFVS 219 +PPQ R+ P P RSA + GR + ++++ N P S A Sbjct: 353 LPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPA-------PPPAIPGRSAPALPP 405 Query: 220 VHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLASLAP 348 + R+ +P PS SAP P P ++ P+ P A AP Sbjct: 406 LGNASRTSTPPVPTPPSLPPSAP-PSLPPSAPPSLPMGAPAAP 447 Score = 20.8 bits (42), Expect(2) = 1.2 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 9 PTPPYRHHLTGSSPAP 56 P PP R + GS P P Sbjct: 339 PPPPPRSNAAGSIPLP 354
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +1 Query: 256 PPSPSSQRSA-PIPHTPHTSGPATPN 330 PPSP + RS+ PIPH P S P+ P+ Sbjct: 139 PPSPPTPRSSTPIPHPPRRSLPSPPS 164
>TFE3_MOUSE (Q64092) Transcription factor E3 (Fragment)| Length = 446 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGP--ATPN 330 PP PSS + P P T H +GP + PN Sbjct: 92 PPGPSSAQPLPAPETAHATGPTGSAPN 118
>MAGD1_PIG (Q6ITT4) Melanoma-associated antigen D1 (MAGE-D1 antigen)| Length = 784 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 214 VSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLASLAP 348 ++V + + R+ P +P + RSAP+P T + A PN+ P Sbjct: 261 LNVEESSSGDQRRAPLAPGTWRSAPVPITTQSPPGAPPNVLWQTP 305
>TIEG3_MOUSE (Q8K1S5) Transforming growth factor-beta-inducible early growth| response protein 3 (TGFB-inducible early growth response protein 3) (TIEG-3) (TGFB-inducible early growth response protein 2b) Length = 502 Score = 30.0 bits (66), Expect = 2.4 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +3 Query: 12 TPPYRHHLTGSSPAPDVFPARPLEERRSGRTG 107 T RH TG SPAP FP P +E+R+ +G Sbjct: 162 TSVIRH--TGESPAPTRFPTGPTQEQRASDSG 191
>YDC9_SCHPO (Q10172) Hypothetical protein C25G10.09c in chromosome I| Length = 1794 Score = 29.6 bits (65), Expect = 3.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATPN 330 PP P+ SAP P P +S P+ PN Sbjct: 1721 PPMPAGPPSAPPPPLPASSAPSVPN 1745
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 29.6 bits (65), Expect = 3.1 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 Query: 208 AFVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLASLA 345 A S+ D HR PP P + R P P TSG P+ L+ Sbjct: 1007 ALQSLPALDPRLHRSTPPGPPNTRQRPGSTDPSTSGSNLPDFELLS 1052
>TFE3_HUMAN (P19532) Transcription factor E3| Length = 743 Score = 29.3 bits (64), Expect = 4.0 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGP--ATPN 330 PP P+S + P P HT+GP + PN Sbjct: 219 PPGPASAQPLPAPEAAHTTGPTGSAPN 245
>RC3H1_MOUSE (Q4VGL6) Roquin (RING finger and C3H zinc finger protein 1)| (Sanroque protein) Length = 1130 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = +3 Query: 285 PNPPHPTHLRPGHPQ----SRLPRPQ 350 P PHP +RP +P+ SRLP PQ Sbjct: 719 PVAPHPAQIRPSYPRDPPYSRLPPPQ 744
>ATN1_HUMAN (P54259) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1185 Score = 29.3 bits (64), Expect = 4.0 Identities = 35/113 (30%), Positives = 44/113 (38%), Gaps = 6/113 (5%) Frame = +3 Query: 9 PTPPYRHHLTGSSPAPDVFPARPLEERRSGRTGPRDTHTH--TVAAKFGCQICVFRTYAN 182 P PPY L S+ P FP P +S P TH H + Q + + N Sbjct: 444 PPPPYGRLLANSNAHPGPFP--PSTGAQSTAHPPVSTHHHHHQQQQQQQQQQQQQQHHGN 501 Query: 183 AKSP----LLSPRLC*CAHH*QE*A*KTPSLSLFSTLCPNPPHPTHLRPGHPQ 329 + P P +HH A +PSL +L P PP P HL P H Q Sbjct: 502 SGPPPPGAFPHPLEGGSSHHAHPYA-MSPSLG---SLRPYPPGPAHLPPPHSQ 550
>TBCD1_MOUSE (Q60949) TBC1 domain family member 1| Length = 1255 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 258 SLSLFSTLCPNPPHPTHLRPGHPQSRLPRPQSL 356 +LS F CP PP P PG Q +L R S+ Sbjct: 590 TLSHFPVECPAPPEPAQSSPGVSQRKLMRYHSV 622
>WASL_RAT (O08816) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATP 327 PP PS P P PH+SGP P Sbjct: 276 PPPPSRGGPPPPPPPPHSSGPPPP 299
>WASL_MOUSE (Q91YD9) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATP 327 PP PS P P PH+SGP P Sbjct: 276 PPPPSRGGPPPPPPPPHSSGPPPP 299
>PODXL_RABIT (Q28645) Podocalyxin-like protein 1 precursor| Length = 551 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 253 LPPSPSSQRSAPIPHTPHTSGPATPNLASLA 345 +PPSP+S S+P P +P S P+ S A Sbjct: 248 MPPSPASPSSSPFPSSPSPSPALQPSGPSAA 278
>CD008_MOUSE (Q8CGI1) Protein C4orf008 homolog (Fragment)| Length = 944 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 262 SPSSQRSAPIPHTPHTSGPATPNLASLAP 348 SPS+ A PH P+ + P+ P A+ AP Sbjct: 683 SPSALSPASTPHLPNLAAPSFPKTATTAP 711
>RT03_OENBE (P27754) Mitochondrial ribosomal protein S3| Length = 550 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 91 RRSSRGRAGKTSGAGEEPVRWCRYGGVG 8 RR R + GK S G+E RW +G VG Sbjct: 77 RRPRRLKRGKKSRPGKEKARWWEFGKVG 104
>WASL_BOVIN (Q95107) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATP 327 PP PS P P PH+SGP P Sbjct: 279 PPPPSRGGPPPPPPPPHSSGPPPP 302
>WASIP_HUMAN (O43516) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) (PRPL-2 protein) Length = 503 Score = 28.5 bits (62), Expect = 6.9 Identities = 26/97 (26%), Positives = 34/97 (35%) Frame = +1 Query: 37 QVPPQPRTFSRPGPWRSAGAGGRVLVTHTHTQSLPNSDVKFAFFALTPTLSLLYSRLAFV 216 Q PP P SRPGP + + T LP ++ + + TP L Sbjct: 305 QAPPPPPPPSRPGPPPLPPSSSG----NDETPRLPQRNLSLS--SSTPPLP--------- 349 Query: 217 SVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATP 327 LPP PS + P+ P SGP P Sbjct: 350 -----SPGRSGPLPPPPSERPPPPVRDPPGRSGPLPP 381
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 262 SPSSQRSAPIPHTPHTSGPATPN 330 +P S +AP TP TSGP TPN Sbjct: 24 TPPSAGAAPGAATPPTSGPPTPN 46
>WSC3_YEAST (Q12215) Cell wall integrity and stress response component 3| precursor Length = 556 Score = 28.5 bits (62), Expect = 6.9 Identities = 19/79 (24%), Positives = 35/79 (44%) Frame = +1 Query: 115 THTHTQSLPNSDVKFAFFALTPTLSLLYSRLAFVSVHITDRSEHRKLPPSPSSQRSAPIP 294 T + T S +S + T + + ++S + S SEH + SS S +P Sbjct: 232 TSSTTSSTTSSTTSSTTSSTTSSTTSIFSVTSSSSSITLSSSEHTTVDSRTSSPSSTLVP 291 Query: 295 HTPHTSGPATPNLASLAPN 351 + +S +TP + S+ P+ Sbjct: 292 VSSSSSTLSTPKVTSMTPS 310
>ATG12_BOVIN (Q3T0W7) Autophagy-related protein 12 (APG12-like)| Length = 140 Score = 28.5 bits (62), Expect = 6.9 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 250 KLPPSPSSQRSAPIPHTPHTSGPATPNLASLAP 348 +LPPS + + P +P T+ P P+ A+++P Sbjct: 10 QLPPSTAPEAEVPTEVSPETATPEPPSSAAVSP 42
>RC3H1_HUMAN (Q5TC82) Roquin (RING finger and C3H zinc finger protein 1)| Length = 1133 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 4/25 (16%) Frame = +3 Query: 285 PNPPHPTHLRPGH----PQSRLPRP 347 P PHPT +RP + P SRLP P Sbjct: 720 PVAPHPTQIRPSYLREPPYSRLPPP 744
>HRG_HUMAN (P04196) Histidine-rich glycoprotein precursor| (Histidine-proline-rich glycoprotein) (HPRG) Length = 525 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 232 DRSEHRKLPPSPSSQRSAPIPHTPHTSGPATP 327 +RS K P P R PH PH GP P Sbjct: 269 ERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP 300
>WASL_HUMAN (O00401) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 28.5 bits (62), Expect = 6.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATP 327 PP PS P P PH SGP P Sbjct: 279 PPPPSRGGPPPPPPPPHNSGPPPP 302
>GCSP_BURS3 (Q39KU1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 211 FVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPN 330 F++ I R E R + + + P+ H PHT+ T N Sbjct: 886 FIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTAN 925
>GCSP_BURPS (Q63PL2) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 211 FVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPN 330 F++ I R E R + + + P+ H PHT+ T N Sbjct: 886 FIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTAN 925
>GCSP_BURP1 (Q3JY08) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 211 FVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPN 330 F++ I R E R + + + P+ H PHT+ T N Sbjct: 886 FIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTAN 925
>GCSP_BURMA (Q62FN1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 211 FVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPN 330 F++ I R E R + + + P+ H PHT+ T N Sbjct: 886 FIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTAN 925
>TRPC2_BOVIN (O62826) Short transient receptor potential channel 2 homolog| (TrpC2) (btrp2) Length = 432 Score = 28.1 bits (61), Expect = 9.0 Identities = 32/123 (26%), Positives = 42/123 (34%), Gaps = 29/123 (23%) Frame = +1 Query: 43 PPQPRTFSRPGPWRSAGAGGR---------------VLVTHTHTQSLPNSDVKFAFFALT 177 PP P TF+ PG G G R + + D+ LT Sbjct: 254 PPIP-TFANPGAGAGPGEGERGSYRLRVIKALVQRYIETAQREFEETRRKDLGNRLTELT 312 Query: 178 PTLSLLYSRLAFVSVHITDRSEHRKLPPSPSSQRSA--------------PIPHTPHTSG 315 T+S L S +A V + + R PP +S S PIP TP + Sbjct: 313 KTVSRLQSEVAGVQRAVVEAGPRR--PPGGASVLSRYITRVRNSFQNLGPPIPETPELTV 370 Query: 316 PAT 324 PAT Sbjct: 371 PAT 373
>PRD12_HUMAN (Q9H4Q4) PR domain zinc finger protein 12 (PR domain-containing| protein 12) Length = 367 Score = 28.1 bits (61), Expect = 9.0 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +1 Query: 196 YSRLAFVSVHITDRSEHRKLPPSPSSQRSAPIPHTPHTSGPATPNLASLA 345 YS+LA + H + R PPS + Q +P PH PA A+ A Sbjct: 308 YSQLAGLRAH---QKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAA 354
>SWC5_USTMA (Q4P6D5) SWR1-complex protein 5| Length = 376 Score = 28.1 bits (61), Expect = 9.0 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +1 Query: 205 LAFVSVHITDRSEHRKLPPSPSSQRSAPIPHTP----HTSGPATPNLASLAP 348 L ++S I + P+PS+ SAP+P +P +S P+ P A P Sbjct: 241 LKYLSSQIASPTSTTSSAPAPSASASAPLPTSPASTSTSSSPSRPQPARPTP 292
>WASIP_MOUSE (Q8K1I7) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) Length = 493 Score = 28.1 bits (61), Expect = 9.0 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 238 SEHRK-LPPSPSSQRSAPIPHTPHTSGPATPNLASLAP 348 S HR+ +PP PS P+P TP P L S AP Sbjct: 268 SMHREAVPPPPSQTSKPPVPSTPR------PGLGSQAP 299
>MYCLA_XENLA (Q05404) L-myc A protein (L-myc 1 protein)| Length = 344 Score = 28.1 bits (61), Expect = 9.0 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 7/57 (12%) Frame = +1 Query: 199 SRLAFVSVHITDRSEHRKLPPSPSSQRSAPIPHTP-------HTSGPATPNLASLAP 348 ++L +S+H + +LPP P+S P H+P TS PA +S P Sbjct: 190 TKLFHISIHQQQHNYAARLPPEPNSMSPQPNFHSPIKEEPGEVTSPPALQQCSSPMP 246
>CSR2B_HUMAN (Q9H8E8) Cysteine-rich protein 2-binding protein (CSRP2-binding| protein) (CRP2BP) (CRP2-binding partner) Length = 782 Score = 28.1 bits (61), Expect = 9.0 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +1 Query: 130 QSLPNSDVKFAFFALTPTLSLLYSRLA-FVSVHITDRSEHRKLPPSPSSQRSAPIPHTPH 306 +S ++ VKF P + L + F S+ +DR+ PSPS SAP H Sbjct: 284 RSTSSTPVKFISRGRRPDVILEKGEVIDFSSLSSSDRTPLTSPSPSPSLDFSAPGTPASH 343 Query: 307 TSGPATPNLASLAPN 351 ++ P+ + A L P+ Sbjct: 344 SATPSLLSEADLIPD 358
>CSKI2_HUMAN (Q8WXE0) Caskin-2| Length = 1202 Score = 28.1 bits (61), Expect = 9.0 Identities = 29/112 (25%), Positives = 42/112 (37%), Gaps = 10/112 (8%) Frame = +1 Query: 43 PPQPR----TFSRPGPWRSAGAG---GRVLVTHTHTQSLPNSDVKFAFFALTPTLSLLYS 201 PP+P+ + SRPGP G G V T +L + A +P+++ + Sbjct: 791 PPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPA 850 Query: 202 RLAFVSVHITDRSEHRKLPPSPS---SQRSAPIPHTPHTSGPATPNLASLAP 348 R S R+ + PP P S S P P P G P + P Sbjct: 851 RGTPRSQSFALRARRKGPPPPPPKRLSSVSGPSPEPPPLDGSPGPKEGATGP 902
>KBTB9_MOUSE (Q80T74) Kelch repeat and BTB domain-containing protein 9| Length = 655 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 253 LPPSPSSQRSAPIPHT-PHTSGPATPNLA 336 LPP P +Q SA +P + P T+GP T + A Sbjct: 42 LPPPPPAQPSAALPSSVPATNGPPTTDSA 70
>BCL9_DROME (Q961D9) Bcl-9 homolog (Protein legless)| Length = 1469 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATPNLASL 342 PP S QRSA +P + P++PN SL Sbjct: 765 PPYHSIQRSASVPIATQSPNPSSPNNLSL 793
>NACAM_MOUSE (P70670) Nascent polypeptide-associated complex alpha subunit,| muscle-specific form (Alpha-NAC, muscle-specific form) Length = 2187 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 250 KLPPSPSSQRSAPIPHTPHTSGPATPNLASLAP 348 KL P+P S + AP+ P T P +P A + P Sbjct: 744 KLSPTPPSSKGAPV---PSTGAPPSPKGAPIVP 773
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 256 PPSPSSQRSAPIPHTPHTSGPATPNLASLAP 348 PPSP + P P TP + P +P S AP Sbjct: 290 PPSPPPSPAPPTPPTPPSPSPPSPVPPSPAP 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,670,225 Number of Sequences: 219361 Number of extensions: 1224683 Number of successful extensions: 5378 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 4655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5332 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)