| Clone Name | bastl33d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LKH1_SCHPO (Q10156) Dual specificity protein kinase lkh1 (EC 2.7... | 35 | 0.063 | 2 | MMP9_CANFA (O18733) Matrix metalloproteinase-9 precursor (EC 3.4... | 29 | 4.5 | 3 | YJI2_YEAST (P47031) Hypothetical 82.5 kDa protein in EXO70-ARP4 ... | 29 | 4.5 | 4 | MMP9_RAT (P50282) Matrix metalloproteinase-9 precursor (EC 3.4.2... | 29 | 4.5 |
|---|
>LKH1_SCHPO (Q10156) Dual specificity protein kinase lkh1 (EC 2.7.12.1)| Length = 575 Score = 35.4 bits (80), Expect = 0.063 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 7/69 (10%) Frame = -2 Query: 250 NQDLLDHSHHPP-------SPQKVIQGHQLSLSPSHVLNSQKR**NLSHQSLNLHPPPLL 92 NQ HSHHPP S Q V++ + PSH NL HQ ++ PP++ Sbjct: 14 NQSPFPHSHHPPLHNPLPVSCQPVLRPPPVPQVPSHWYPVSLPSPNLPHQPIS--KPPVI 71 Query: 91 MTLPRDQTH 65 LP+ Q H Sbjct: 72 PNLPKLQVH 80
>MMP9_CANFA (O18733) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 704 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 410 GRTGAPSKSLVRPPTLGPDETSSLPQD 330 G TG P+ PPT GP E ++P D Sbjct: 481 GPTGPPAAGPTGPPTAGPSEAPTVPVD 507
>YJI2_YEAST (P47031) Hypothetical 82.5 kDa protein in EXO70-ARP4 intergenic| region Length = 731 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 203 LLRTRRMMTMIQKVLIQIKISKRSKMSQT 289 LL+ RR TM+Q +++ +K ++RSK S + Sbjct: 157 LLKLRRAYTMLQDIMVTVKKAERSKNSSS 185
>MMP9_RAT (P50282) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 708 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = -1 Query: 413 VGRTGAPSKSLVRPPTLGPDET---SSLPQD 330 V TGAPS PPT GP E SS P D Sbjct: 486 VAPTGAPSPGPTGPPTAGPSEAPTESSTPDD 516 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,980,697 Number of Sequences: 219361 Number of extensions: 776024 Number of successful extensions: 1607 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1607 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)