| Clone Name | bastl32e11 |
|---|---|
| Clone Library Name | barley_pub |
>NEB2_MOUSE (Q6R891) Neurabin-2 (Neurabin-II) (Spinophilin) (Protein| phosphatase 1 regulatory subunit 9B) Length = 817 Score = 33.9 bits (76), Expect = 0.21 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 22 PPPPSPLGLQRGAERERKTGGDPPPRVAVIPA 117 PPPP+P G E+ER GG PP+ V PA Sbjct: 255 PPPPAPSG-DGATEKERGPGGQQPPQHRVAPA 285
>NEB2_RAT (O35274) Neurabin-2 (Neurabin-II) (Spinophilin) (Protein| phosphatase 1 regulatory subunit 9B) (Neural tissue-specific F-actin-binding protein II) (p130) (PP1bp134) Length = 817 Score = 33.1 bits (74), Expect = 0.36 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 22 PPPPSPLGLQRGAERERKTGGDPPPRVAVIPA 117 PPPP+P G E++R GG PP+ V PA Sbjct: 255 PPPPAPSG-DAATEKDRGPGGQQPPQHRVAPA 285
>NEB2_HUMAN (Q96SB3) Neurabin-2 (Neurabin-II) (Spinophilin) (Protein| phosphatase 1 regulatory subunit 9B) Length = 815 Score = 32.3 bits (72), Expect = 0.61 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 22 PPPPSPLGLQRGAERERKTGGDPPPRVAVIPA 117 PPPP+P G AE+ER G PP+ V PA Sbjct: 254 PPPPAPSG-DAPAEKERCPAGQQPPQHRVAPA 284
>ENA_DROME (Q8T4F7) Protein enabled| Length = 834 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 22 PPPPSPLGLQRGAERERKTGGDPPPRVAVIPAI 120 PPPP+P + GA GG PPP PA+ Sbjct: 573 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAM 605
>SMC4_HUMAN (Q9NTJ3) Structural maintenance of chromosomes 4-like 1 protein| (Chromosome-associated polypeptide C) (hCAP-C) (XCAP-C homolog) Length = 1288 Score = 30.8 bits (68), Expect = 1.8 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 10 REASPPPPSPLGLQRGAERERKTGGDPPPRVA 105 RE PPPPSP G AE E +G P A Sbjct: 14 REEGPPPPSPDGASSDAEPEPPSGRTESPATA 45
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.3 bits (64), Expect = 5.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 10 REASPPPPSPLGLQRGAERERKTGGDPPPRVAVIPA 117 R ASPPPP + +R+ PPP+ PA Sbjct: 606 RTASPPPPPKRRASPSPQSKRRVSHSPPPKQRSSPA 641
>Y201_ENCCU (Q8ST90) Hypothetical protein ECU02_0010/ECU04_1710| Length = 220 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = -2 Query: 372 LHVHNMIAAIFSHEGNLT*PELKNVSYPLSLRIFLGANGINHSSSRSQNREARALRR 202 L H +++ I+ G +T + +N + P+S ++ ++HS+ S N + +AL R Sbjct: 151 LSCHILLSGIWRSNGFITMKDKRNNNTPVSNPEAPSSDSLSHSTPNSSNLQEKALSR 207
>DYR1B_MOUSE (Q9Z188) Dual specificity tyrosine-phosphorylation-regulated kinase| 1B (EC 2.7.12.1) Length = 589 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +1 Query: 13 EASPPPPSPLGLQRGAE--RERKTGGDPP 93 + SPPPP+P A R R TGG PP Sbjct: 534 DCSPPPPAPAPQHPAASALRTRMTGGRPP 562
>PHEG_AGLNE (P34784) R-phycoerythrin gamma chain, chloroplast precursor| Length = 317 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +2 Query: 341 KMAAIMLCTCSGDQSKFEEMPRSPESLATRDFSASGSC 454 K ++ CS ++++F+EMP S + A+G+C Sbjct: 173 KACFVLAHNCSREEAQFKEMPMSCATFLASKMEATGAC 210
>VNUA_PRVKA (P33485) Probable nuclear antigen| Length = 1733 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 22 PPPPSPLGLQRGAERERKTGGDPPPR 99 PP P P G G+ R R+ GG PP R Sbjct: 293 PPQPPPAG---GSARRRRRGGGPPGR 315
>CWH43_YEAST (P25618) Calcofluor white hypersensitive protein precursor| Length = 953 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 461 VSNKNHLLRNPVSREIPAIGASLQTW 384 V++ +HLL +PV PAI A+LQT+ Sbjct: 766 VNSTHHLLPSPVGELAPAIHATLQTY 791
>ICP4_EHV1V (Q6S6U0) Trans-acting transcriptional protein ICP4 (155 kDa| immediate-early protein) Length = 1487 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +1 Query: 25 PPPSPLGLQRGAERERK-----TGGDPPPRVAVIPA 117 PPPSP RG + +R +GG P P A PA Sbjct: 68 PPPSPAPEPRGGKAKRSPSAAGSGGPPTPAAAAQPA 103
>ICP4_EHV1K (P17473) Trans-acting transcriptional protein ICP4 (155 kDa| immediate-early protein) Length = 1487 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +1 Query: 25 PPPSPLGLQRGAERERK-----TGGDPPPRVAVIPA 117 PPPSP RG + +R +GG P P A PA Sbjct: 68 PPPSPAPEPRGGKAKRSPSAAGSGGPPTPAAAAQPA 103
>ICP4_EHV1B (P28925) Trans-acting transcriptional protein ICP4 (155 kDa| immediate-early protein) Length = 1487 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +1 Query: 25 PPPSPLGLQRGAERERK-----TGGDPPPRVAVIPA 117 PPPSP RG + +R +GG P P A PA Sbjct: 68 PPPSPTPEPRGGKAKRSPSAAGSGGPPTPAAAAQPA 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,953,340 Number of Sequences: 219361 Number of extensions: 1042040 Number of successful extensions: 3681 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3644 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)