| Clone Name | bastl31h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CP6D3_MUSDO (Q964Q7) Cytochrome P450 6d3 (EC 1.14.-.-) (CYPVID3)... | 32 | 0.74 | 2 | PKP3_HUMAN (Q9Y446) Plakophilin-3 | 31 | 2.2 | 3 | CSE1_PAGMA (Q9PTU3) Importin-alpha re-exporter (Chromosome segre... | 30 | 2.8 | 4 | MMPL3_MYCTU (O53657) Putative membrane protein mmpL3 | 30 | 3.7 | 5 | CSE1_DROME (Q9XZU1) Importin-alpha re-exporter (Cellular apoptos... | 30 | 4.8 | 6 | PKP3_MOUSE (Q9QY23) Plakophilin-3 | 29 | 6.3 | 7 | TI50C_DROME (Q9W4V8) Import inner membrane translocase subunit T... | 29 | 8.2 |
|---|
>CP6D3_MUSDO (Q964Q7) Cytochrome P450 6d3 (EC 1.14.-.-) (CYPVID3) (Pyrethroid| resistance cytochrome P450) Length = 520 Score = 32.3 bits (72), Expect = 0.74 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +1 Query: 268 KIFARRNMEGGLSSSDLYREFRDQLAQALLRVEPAILRVLIEVFRQVAEKDF 423 K+F R+ GL DLY +F++Q+ L +PA+L E+ RQ+ DF Sbjct: 43 KVF-RKERPFGLVMYDLYEKFQEQVVGIYLFFKPALLIRDAELARQILTSDF 93
>PKP3_HUMAN (Q9Y446) Plakophilin-3| Length = 797 Score = 30.8 bits (68), Expect = 2.2 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = -1 Query: 414 LRNLAKNFNQHSKNCRFHSKQSLSKLVAKLPVQIGRREPPFHV 286 L L +N +++++N S + +S L+ KLP +G + PP V Sbjct: 675 LTGLIRNLSRNARNKDEMSTKVVSHLIEKLPGSVGEKSPPAEV 717
>CSE1_PAGMA (Q9PTU3) Importin-alpha re-exporter (Chromosome segregation 1-like| protein) (Cellular apoptosis susceptibility protein) Length = 971 Score = 30.4 bits (67), Expect = 2.8 Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 5/102 (4%) Frame = +1 Query: 172 SAAGDPRFPIALLAVAAGDGDQGTRIAAAAYLKIFARRNM-----EGGLSSSDLYREFRD 336 S G+ +P+ LL + D R+ AA K + +RN E S + Sbjct: 35 SVEGNQNYPLLLLTLLEKSQDNVIRVCAAVTFKNYIKRNWRVIEDEPNKVSDPDRTAIKA 94 Query: 337 QLAQALLRVEPAILRVLIEVFRQVAEKDFVKENSWPELVPQL 462 + +L I + L + + +DF ++ WP+L+ ++ Sbjct: 95 NIVNLMLSSPEQIQKQLSDAISIIGREDFPQK--WPDLLTEM 134
>MMPL3_MYCTU (O53657) Putative membrane protein mmpL3| Length = 944 Score = 30.0 bits (66), Expect = 3.7 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +1 Query: 175 AAGDPRFPIALLAVAAGDGDQGTRI-----AAAAYLKIFARRNMEGGLSSSDLYR 324 AAGDP P A L + DGD A K RR G LS+ DL R Sbjct: 885 AAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGGALSAQDLLR 939
>CSE1_DROME (Q9XZU1) Importin-alpha re-exporter (Cellular apoptosis| susceptibility protein homolog) Length = 975 Score = 29.6 bits (65), Expect = 4.8 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 8/98 (8%) Frame = +1 Query: 193 FPIALL-AVAAGDGDQGTRIAAAAYLKIFARRNMEGGLSSSDLYR-------EFRDQLAQ 348 +PI LL + D TR+A A K + +RN L S R + + Sbjct: 42 YPILLLNLIDKAQMDMTTRVAGAIAFKNYIKRNWAAHLDSDGPDRIHESDRNTIKTLIVT 101 Query: 349 ALLRVEPAILRVLIEVFRQVAEKDFVKENSWPELVPQL 462 +L A+ + L + + + DF K+ WP+L+ ++ Sbjct: 102 LMLHSPVALQKQLSDAVSIIGKYDFPKK--WPQLIDEM 137
>PKP3_MOUSE (Q9QY23) Plakophilin-3| Length = 797 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = -1 Query: 414 LRNLAKNFNQHSKNCRFHSKQSLSKLVAKLPVQIGRREPPFHV 286 L L +N +++++N S + +S L+ KLP +G + PP V Sbjct: 675 LTGLIRNLSRNARNKDEMSTKVVSHLIEKLPGSVGEKCPPAEV 717
>TI50C_DROME (Q9W4V8) Import inner membrane translocase subunit TIM50-C,| mitochondrial precursor Length = 428 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 223 GDGDQGTRIAAAAYLKIFARRNMEGGLSSSDLYREFRDQLAQ 348 G+ D G + A+LKI A+ N++ YR+F D + Q Sbjct: 350 GNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYRQFDDPINQ 391 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,026,551 Number of Sequences: 219361 Number of extensions: 736249 Number of successful extensions: 2570 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2570 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)