| Clone Name | bastl31g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SH24A_RAT (Q6AYC8) SH2 domain-containing protein 4A | 31 | 1.0 | 2 | SH24A_MOUSE (Q9D7V1) SH2 domain-containing protein 4A | 31 | 1.0 | 3 | SH24A_HUMAN (Q9H788) SH2 domain-containing protein 4A (Protein S... | 30 | 1.3 | 4 | HMGN3_RAT (Q66H40) High mobility group nucleosome-binding domain... | 29 | 3.9 | 5 | FOXO4_HUMAN (P98177) Putative fork head domain transcription fac... | 28 | 8.7 |
|---|
>SH24A_RAT (Q6AYC8) SH2 domain-containing protein 4A| Length = 422 Score = 30.8 bits (68), Expect = 1.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 194 ESGPGFDGPRAEGGKEEDWRGGSARNWWVLVLGE 93 ES P P+ E GK W+ G+ + WV V+GE Sbjct: 50 ESLPVKSRPKKENGKSVHWKLGADKQVWVWVMGE 83
>SH24A_MOUSE (Q9D7V1) SH2 domain-containing protein 4A| Length = 421 Score = 30.8 bits (68), Expect = 1.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 194 ESGPGFDGPRAEGGKEEDWRGGSARNWWVLVLGE 93 ES P P+ E GK W+ G+ + WV V+GE Sbjct: 50 ESLPVKSRPKKENGKSVHWKLGADKQVWVWVMGE 83
>SH24A_HUMAN (Q9H788) SH2 domain-containing protein 4A (Protein SH(2)A)| Length = 454 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 194 ESGPGFDGPRAEGGKEEDWRGGSARNWWVLVLGE 93 ES P P+ E GK W+ G+ + WV V+GE Sbjct: 50 ESLPVKPRPKKENGKSVHWKLGADKEVWVWVMGE 83
>HMGN3_RAT (Q66H40) High mobility group nucleosome-binding domain-containing| protein 3 Length = 95 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 13 GKKYNQAAKRRGEERQSAAIRVRGPSASPKTRTHQ 117 G K N+AAK + EE+Q A PSA+ T+ + Sbjct: 53 GTKINRAAKGKKEEKQEAGKEGTAPSANGDTKAEE 87
>FOXO4_HUMAN (P98177) Putative fork head domain transcription factor AFX1| (Forkhead box protein O4) Length = 505 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 1 IHPKGKKYNQAAKRRGEERQSAAIRVRGPSASPKTR 108 ++P+G K +A +RR S++ +RG S +PK + Sbjct: 180 LNPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKK 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.124 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,293,563 Number of Sequences: 219361 Number of extensions: 239130 Number of successful extensions: 692 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)