| Clone Name | bastl31f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCRN1_MOUSE (Q9CZC8) Secernin-1 | 29 | 6.8 | 2 | PKSM_BACSU (P40872) Putative polyketide synthase pksM | 29 | 6.8 | 3 | PCBH_PROMA (Q7VBC2) Divinyl chlorophyll a/b light-harvesting pro... | 28 | 8.9 | 4 | ELK3_HUMAN (P41970) ETS domain-containing protein Elk-3 (ETS-rel... | 28 | 8.9 | 5 | CLCKA_HUMAN (P51800) Chloride channel protein ClC-Ka (Chloride c... | 28 | 8.9 |
|---|
>SCRN1_MOUSE (Q9CZC8) Secernin-1| Length = 414 Score = 28.9 bits (63), Expect = 6.8 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 388 GEMLRSTMIRAEGQIQEACVDILSSQHPP 302 G LR TM+ E Q EA +ILSS PP Sbjct: 365 GRTLRKTMLELEKQGLEAMDEILSSPEPP 393
>PKSM_BACSU (P40872) Putative polyketide synthase pksM| Length = 4262 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -3 Query: 424 MDEL**LSQCSSGEMLRSTMIRAEGQIQEA 335 +DE+ QC S E++ + M++AEGQI EA Sbjct: 134 LDEI--YEQCRSQELVHTGMMKAEGQIYEA 161
>PCBH_PROMA (Q7VBC2) Divinyl chlorophyll a/b light-harvesting protein pcbH| Length = 352 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +2 Query: 320 KDVHAGLLNLAFRSDHGGTKHFATGTLGKLSQFVHGNGLQGA 445 +DV +G LAF GG H AT +G+ ++F G+GL A Sbjct: 200 EDVMSGHAFLAFLQISGGAFHIATRQIGEYTKF-KGDGLLSA 240
>ELK3_HUMAN (P41970) ETS domain-containing protein Elk-3 (ETS-related protein| NET) (ETS-related protein ERP) (SRF accessory protein 2) (SAP-2) Length = 407 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +1 Query: 241 SPLPSLHRAPRLSCPGHDD------GLADAAKKGCPRRPPESGLPLG 363 SPLPS HR+ L HD L+ +K P PP++ P G Sbjct: 250 SPLPSEHRSLFLEAACHDSDSLEPLNLSSGSKTKSPSLPPKAKKPKG 296
>CLCKA_HUMAN (P51800) Chloride channel protein ClC-Ka (Chloride channel Ka)| (ClC-K1) Length = 687 Score = 28.5 bits (62), Expect = 8.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 226 VTRGASPLPSLHRAPRLSCPGHDDGLADAAKKGCPRRP 339 + + A + +L P PGH L D +GCP P Sbjct: 593 IVQRAQLVQALQAEPPSRAPGHQQCLQDILARGCPTEP 630 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,177,499 Number of Sequences: 219361 Number of extensions: 824068 Number of successful extensions: 3177 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3177 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)