| Clone Name | bastl31a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCRA_LIMPO (Q25390) Alpha-scruin | 29 | 3.9 | 2 | MUKF_VIBCH (Q9KRC6) Chromosome partition protein mukF | 28 | 6.7 | 3 | DYC1_CAEEL (Q8STF6) Dystrophin-like protein 1 (Dyb-1-binding and... | 28 | 8.8 | 4 | PTPA1_ASPFU (Q4WMU5) Serine/threonine-protein phosphatase 2A act... | 28 | 8.8 | 5 | SNX19_HUMAN (Q92543) Sorting nexin-19 | 28 | 8.8 |
|---|
>SCRA_LIMPO (Q25390) Alpha-scruin| Length = 918 Score = 28.9 bits (63), Expect = 3.9 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +2 Query: 14 YPQPPTSIPSSAALPSGHRAPMAANVMLA--IHDKKAAAVDLYRPLRQYI 157 Y + PTS PSS A P P + IH++ AA + R R+YI Sbjct: 396 YYEVPTSTPSSKAKPQPGSKPTSVKYKKQPDIHERNEAAKKVQRRWRRYI 445
>MUKF_VIBCH (Q9KRC6) Chromosome partition protein mukF| Length = 445 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 92 MLAIHDKKAAAVDLYRPLRQYIAS 163 ML +H ++ AA+DL LR Y+AS Sbjct: 370 MLKVHKEQGAAIDLALVLRDYLAS 393
>DYC1_CAEEL (Q8STF6) Dystrophin-like protein 1 (Dyb-1-binding and CAPON-related| protein) Length = 887 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 14 YPQPPTSIPSSAALPSGHRAPM 79 YPQ P +PSS++LP G +P+ Sbjct: 378 YPQMPGMLPSSSSLPFGLSSPV 399
>PTPA1_ASPFU (Q4WMU5) Serine/threonine-protein phosphatase 2A activator 1 (EC| 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-1) (PPIase PTPA-1) (Rotamase PTPA-1) (Phosphotyrosyl phosphatase activator 1) Length = 473 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 20 QPPTSIPSSAALPSGHRAPMAA 85 +PPTS+P ++ LP G AP A Sbjct: 426 KPPTSLPDTSRLPPGPMAPTRA 447
>SNX19_HUMAN (Q92543) Sorting nexin-19| Length = 992 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 17 PQPPTSIPSSAA---LPSGHRAPMAANVMLAIHDKKAAA 124 P PTS+P A LP G +P+AA V L+ + + +A Sbjct: 285 PSVPTSLPLIAEVEQLPEGRASPVAAPVFLSYSEPEGSA 323 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.306 0.129 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,319,302 Number of Sequences: 219361 Number of extensions: 195384 Number of successful extensions: 667 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits)