| Clone Name | bastl30e07 |
|---|---|
| Clone Library Name | barley_pub |
>PI4KA_HUMAN (P42356) Phosphatidylinositol 4-kinase alpha (EC 2.7.1.67)| (PI4-kinase alpha) (PtdIns-4-kinase alpha) (PI4K-alpha) Length = 2044 Score = 33.1 bits (74), Expect = 0.39 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%) Frame = -1 Query: 338 VMVHTLTSITRIFLVFMSPSLCKLPQQTTPSHANINSYLVLLLTSRH------VMRGRHP 177 V+VH++T R FLV SP L KL + + H + + + +T+ H VM G+ Sbjct: 440 VVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISVTNEHSESTLNVMSGKKS 499 Query: 176 HPTVSRQ 156 P++ Q Sbjct: 500 QPSMYEQ 506
>NEUR_DROVI (Q24746) Protein neuralized| Length = 747 Score = 30.4 bits (67), Expect = 2.5 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -1 Query: 449 HINSPNTHNALQALASSSHIRDL*TNKRVCTP--PTYGHVMVHTLTSITRIF-LVFMSPS 279 H N + HNA A A+++H+ + ++ + +P +H L I + F LV SPS Sbjct: 28 HHNHNHNHNAAAAAAAAAHVLAMENSELLMSPKDKMSSKKKMHLLKKIKKRFGLVRRSPS 87 Query: 278 LCKLPQQTTP 249 C P P Sbjct: 88 SCPGPNNLPP 97
>PI4KA_BOVIN (O02811) Phosphatidylinositol 4-kinase alpha (EC 2.7.1.67)| (PI4-kinase alpha) (PtdIns-4-kinase alpha) (PI4K-alpha) Length = 2043 Score = 29.6 bits (65), Expect = 4.3 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%) Frame = -1 Query: 338 VMVHTLTSITRIFLVFMSPSLCKLPQQTTPSHANINSYLVLLLTSRH------VMRGRHP 177 V+VH++T R FLV SP L KL + + H + + + +T+ H V G+ Sbjct: 440 VVVHSVTPSLRDFLVVPSPVLVKLYKCHSQYHTVAGNDIKISVTNEHAESTLNVASGKKS 499 Query: 176 HPTVSRQ 156 P++ Q Sbjct: 500 QPSMYEQ 506
>DSX_DROME (P23023) Protein doublesex| Length = 549 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 364 YAHPPHMGM*WC-TLSQASLGSS*YSCHHHYANYHNKPHPHMLT*IAI 224 +AH HM +++Q S +S HHH+ N+H PH T A+ Sbjct: 186 HAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTAL 233
>DRL21_ARATH (Q9LRR5) Putative disease resistance protein At3g14460| Length = 1424 Score = 28.5 bits (62), Expect = 9.6 Identities = 22/76 (28%), Positives = 31/76 (40%), Gaps = 6/76 (7%) Frame = -1 Query: 278 LCKLPQQTTPSHANINSYLVLLLTSRHVMRGRHPHPTVS----RQANKT--TRSLSPH*S 117 L LP+ T S+ N++ L++ S G HP T+ R K T SL P S Sbjct: 1104 LTSLPENLTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDCKKLNFTESLQPTRS 1163 Query: 116 SQAWGYTRVASDSYHL 69 Y + S +L Sbjct: 1164 YSQLEYLFIGSSCSNL 1179
>HAND1_SHEEP (Q28555) Heart- and neural crest derivatives-expressed protein 1| (Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (eHAND) Length = 204 Score = 28.5 bits (62), Expect = 9.6 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -2 Query: 295 YSCHHHYANYHNKPHP 248 Y+ HHH+ ++H+ PHP Sbjct: 7 YAHHHHHHHHHHHPHP 22
>OTX1L_BRARE (Q90267) Homeobox protein Otx1l (ZOTX3)| Length = 338 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -3 Query: 471 LNPMXCHAHQQP--QHTQCSXSTSIELTHKRSLN*QESMHTPH 349 L PM HAH P H+Q S + ++ H Q S H PH Sbjct: 244 LAPMTGHAHHHPHAHHSQLSTAAAVSGHHHPHHIGQSSGHHPH 286 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,267,721 Number of Sequences: 219361 Number of extensions: 1371341 Number of successful extensions: 3198 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3168 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)