| Clone Name | bastl29h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOP14_HUMAN (P78316) Probable nucleolar complex protein 14 | 59 | 4e-09 | 2 | NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14 | 58 | 1e-08 | 3 | NOP14_SCHPO (O43051) Probable nucleolar complex protein 14 | 41 | 0.002 | 4 | NOP14_YARLI (Q6C2F4) Probable nucleolar complex protein 14 | 33 | 0.34 | 5 | GUX1_TRIHA (Q9P8P3) Exoglucanase 1 precursor (EC 3.2.1.91) (Exog... | 30 | 2.9 | 6 | RAGE_BOVIN (Q28173) Advanced glycosylation end product-specific ... | 28 | 8.4 | 7 | FA44B_XENTR (Q68FB1) Protein FAM44B | 28 | 8.4 |
|---|
>NOP14_HUMAN (P78316) Probable nucleolar complex protein 14| Length = 857 Score = 59.3 bits (142), Expect = 4e-09 Identities = 29/67 (43%), Positives = 44/67 (65%) Frame = +1 Query: 256 SNPFEAIWSRRKFDVLGKKRKGEERRTPRSRSDAVHKRENTLLKEFEQSAKSSVFHDRRI 435 SNPFE +R+KF +LG+K + + SR+ A+ KR TLLKE+++ KS+VF D+R Sbjct: 29 SNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRF 88 Query: 436 GERDETL 456 GE + + Sbjct: 89 GEYNSNM 95
>NOP14_MOUSE (Q8R3N1) Probable nucleolar complex protein 14| Length = 860 Score = 57.8 bits (138), Expect = 1e-08 Identities = 28/66 (42%), Positives = 43/66 (65%) Frame = +1 Query: 259 NPFEAIWSRRKFDVLGKKRKGEERRTPRSRSDAVHKRENTLLKEFEQSAKSSVFHDRRIG 438 NPFE +R+KF +LG+K + + SR+ A+ KR TLLKE+++ KS+VF D+R G Sbjct: 30 NPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRFG 89 Query: 439 ERDETL 456 E + + Sbjct: 90 EYNSNI 95
>NOP14_SCHPO (O43051) Probable nucleolar complex protein 14| Length = 827 Score = 40.8 bits (94), Expect = 0.002 Identities = 23/66 (34%), Positives = 35/66 (53%) Frame = +1 Query: 259 NPFEAIWSRRKFDVLGKKRKGEERRTPRSRSDAVHKRENTLLKEFEQSAKSSVFHDRRIG 438 N F+ +++RKFDV G++ KG E + SR R T+ E ++ +S DRR G Sbjct: 52 NLFDRQFTKRKFDVGGRRVKGTEGKPGVSRGVGEELRRRTIGAELKKRNRSGAIIDRRFG 111 Query: 439 ERDETL 456 E + L Sbjct: 112 ENNPHL 117
>NOP14_YARLI (Q6C2F4) Probable nucleolar complex protein 14| Length = 832 Score = 33.1 bits (74), Expect = 0.34 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = +1 Query: 250 ERSNPFEAIWSRRKFDVLGKKRKGEERRTPRSRSDAVHKRENTLLKEFEQSAKSSVFHDR 429 ++ NPF+ +R+K D+ G+ +G R S+ R E + + DR Sbjct: 50 QQFNPFDVKVARKKHDIGGRTVRGSVGRPGLSKLSGEEARMEARKLELQNKGRVGGVFDR 109 Query: 430 RIGERDETL 456 R GE D + Sbjct: 110 RFGEGDSNM 118
>GUX1_TRIHA (Q9P8P3) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (CBHI) (1,4-beta-cellobiohydrolase) Length = 505 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 297 RARQEAQGRGEAHPPLPLRRCPQEGEHPAQG 389 RA+Q + E HPPL ++C G P QG Sbjct: 16 RAQQVCTQQAETHPPLTWQKCTASGCTPQQG 46
>RAGE_BOVIN (Q28173) Advanced glycosylation end product-specific receptor| precursor (Receptor for advanced glycosylation end products) Length = 416 Score = 28.5 bits (62), Expect = 8.4 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 274 IWSRRKFDVLGKKRKGEERRTPRSRSDAVHKRENTLLKEFEQSAKSS 414 +W RR+ +RKG+ER+ P ++ + +R E ++A+SS Sbjct: 372 VWHRRR------QRKGQERKVPENQEEEEEERAELNQPEEPEAAESS 412
>FA44B_XENTR (Q68FB1) Protein FAM44B| Length = 169 Score = 28.5 bits (62), Expect = 8.4 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +3 Query: 261 PLRGHLVAPQVRRARQE---AQGRGEAHPPLPLRRC-PQEGEHP 380 P H+ PQ+ +A QE AQ + E PPLP PQE E P Sbjct: 119 PKLNHIFRPQIEKAIQEYLAAQTKEEPAPPLPPGPPEPQEQEPP 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,520,994 Number of Sequences: 219361 Number of extensions: 420974 Number of successful extensions: 2018 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2015 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)