| Clone Name | bastl29e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHD5_HUMAN (Q8TDI0) Chromodomain helicase-DNA-binding protein 5 ... | 30 | 2.3 | 2 | IP3KB_RAT (P42335) Inositol-trisphosphate 3-kinase B (EC 2.7.1.1... | 29 | 6.6 | 3 | MAN1_MOUSE (Q9WU40) Inner nuclear membrane protein Man1 (LEM dom... | 28 | 8.6 | 4 | NTR2_MOUSE (P70310) Neurotensin receptor type 2 (NT-R-2) (Low-af... | 28 | 8.6 |
|---|
>CHD5_HUMAN (Q8TDI0) Chromodomain helicase-DNA-binding protein 5 (EC 3.6.1.-)| (ATP-dependent helicase CHD5) (CHD-5) Length = 1954 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 82 PPSPLPSYCSWLCPRWPCPPL 144 PP P WLCPR CPPL Sbjct: 445 PPLPEIPNGEWLCPRCTCPPL 465
>IP3KB_RAT (P42335) Inositol-trisphosphate 3-kinase B (EC 2.7.1.127) (Inositol| 1,4,5-trisphosphate 3-kinase B) (IP3K B) (IP3 3-kinase B) (IP3K-B) Length = 934 Score = 28.9 bits (63), Expect = 6.6 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 186 TGSAPSPCGRRSLDQRRAWPSRTEP-RAVGGQGAWRPPLL 70 TGSAP P R P R E +VGGQG+W P ++ Sbjct: 346 TGSAPEPIRTHI----REPPGRVERVHSVGGQGSWTPEVI 381
>MAN1_MOUSE (Q9WU40) Inner nuclear membrane protein Man1 (LEM domain containing| protein 3) (Fragment) Length = 331 Score = 28.5 bits (62), Expect = 8.6 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Frame = +2 Query: 80 GLQAPCPPTARGSVRDGH------ARRWSRLRRPQGDGAEP 184 GL+AP P A G V GH W RRP G +P Sbjct: 169 GLRAPPAPPAAGEVTGGHPGERRKPHSWWGARRPAGPEPQP 209
>NTR2_MOUSE (P70310) Neurotensin receptor type 2 (NT-R-2) (Low-affinity| levocabastine-sensitive neurotensin receptor) (NTRL) Length = 417 Score = 28.5 bits (62), Expect = 8.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 175 TVTLWPPQP*PAAGMAIADR 116 T +LWPP+P P+AG+++ R Sbjct: 3 TSSLWPPRPSPSAGLSLEAR 22 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,935,240 Number of Sequences: 219361 Number of extensions: 1128889 Number of successful extensions: 3402 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3401 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)