| Clone Name | bastl29d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FAD21_MYCTU (P63523) Putative fatty-acid--CoA ligase fadD21 (EC ... | 32 | 0.78 | 2 | FAD21_MYCBO (P63524) Putative fatty-acid--CoA ligase fadD21 (EC ... | 32 | 0.78 | 3 | FAD21_MYCLE (P54200) Putative fatty-acid--CoA ligase fadD21 (EC ... | 29 | 5.0 | 4 | SYN_BUCAI (P57441) Asparaginyl-tRNA synthetase (EC 6.1.1.22) (As... | 28 | 8.6 |
|---|
>FAD21_MYCTU (P63523) Putative fatty-acid--CoA ligase fadD21 (EC 6.2.1.-)| (Acyl-CoA synthetase) Length = 578 Score = 32.0 bits (71), Expect = 0.78 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 312 GEVLMVPRTGNPIGGRERTGKVGTLQEVKLLQTGLIQEMVII 437 G +L+ P G P G RTG +G L E ++ G +++M+I+ Sbjct: 425 GAMLVHPSAGTPDGSWLRTGDLGFLSEDEMFIVGRMKDMLIV 466
>FAD21_MYCBO (P63524) Putative fatty-acid--CoA ligase fadD21 (EC 6.2.1.-)| (Acyl-CoA synthetase) Length = 578 Score = 32.0 bits (71), Expect = 0.78 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 312 GEVLMVPRTGNPIGGRERTGKVGTLQEVKLLQTGLIQEMVII 437 G +L+ P G P G RTG +G L E ++ G +++M+I+ Sbjct: 425 GAMLVHPSAGTPDGSWLRTGDLGFLSEDEMFIVGRMKDMLIV 466
>FAD21_MYCLE (P54200) Putative fatty-acid--CoA ligase fadD21 (EC 6.2.1.-)| (Acyl-CoA synthetase) Length = 579 Score = 29.3 bits (64), Expect = 5.0 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 300 QRFQGEVLMVPRTGNPIGGRERTGKVGTLQEVKLLQTGLIQEMVII 437 QR G L P G P G RTG +G + E +L G +++++I+ Sbjct: 422 QRTFGGKLANPSPGTPEGPWLRTGDLGFISEDELFIVGRMKDLLIV 467
>SYN_BUCAI (P57441) Asparaginyl-tRNA synthetase (EC 6.1.1.22)| (Asparagine--tRNA ligase) (AsnRS) Length = 466 Score = 28.5 bits (62), Expect = 8.6 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 321 LMVPRTGNPIGGRERTGKVGTLQEVKLLQTGLIQE 425 ++VP G IGG +R ++ L E +LL+ GL +E Sbjct: 382 ILVPNVGELIGGSQREERIAILDE-RLLELGLKKE 415 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,945,513 Number of Sequences: 219361 Number of extensions: 770105 Number of successful extensions: 2496 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2468 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)