| Clone Name | bastl28g04 |
|---|---|
| Clone Library Name | barley_pub |
>NPAS3_MOUSE (Q9QZQ0) Neuronal PAS domain protein 3 (Neuronal PAS3) (Member of| PAS protein 6) (MOP6) Length = 925 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 21 PLSHGYTVALQTLIILAACHEHSPPCCFVKRLDWCHL 131 PLSHG TV Q + ++ H PP R+D CH+ Sbjct: 302 PLSHGRTVPSQIMGLVVVAHALPPPTINEVRID-CHM 337
>TNC6B_HUMAN (Q9UPQ9) Trinucleotide repeat-containing 6B protein| Length = 1723 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Frame = -3 Query: 376 WN-----PEHLSKFHQEEKSKENPSPPQPNCAGA 290 WN P +K HQ+++ + P PPQP +G+ Sbjct: 806 WNETGRQPNSWNKQHQQQQPPQQPPPPQPEASGS 839
>RAB3C_HUMAN (Q96E17) Ras-related protein Rab-3C| Length = 227 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 346 QEEKSKENPSPPQPNCA 296 Q + KE P PPQPNCA Sbjct: 210 QNTRLKETPPPPQPNCA 226
>SULF1_DROME (Q9VEX0) Extracellular sulfatase SULF-1 homolog precursor (EC| 3.1.6.-) (DmSulf-1) Length = 1114 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 157 IYSSNATRTK*HQSSRFTKQQGGECSWQAARMMRVCSATVYPWERGWR 14 +++SN++ + ++TK G C A CS +Y E+ WR Sbjct: 709 LHASNSSGNSYERGEKYTKSGGHRCFVDATTAKVNCSNVIYDDEKTWR 756
>IE0_NPVAC (P41710) Immediate-early protein IE-0 (Immediate early 0 protein)| (Immediate early transactivator 0) Length = 261 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -1 Query: 282 LNTDESFLEPKRTRESA--NQCCIYRW 208 ++TDE FL+PK E A N CC+ W Sbjct: 218 ISTDERFLKPKECCEYAICNACCVNMW 244
>BIOH_XYLFT (Q87DT3) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +3 Query: 57 LIILAACHEHSPPCCFVKRLDWCHLVRVALEE*MSTSARQQYRTT 191 LI+LAA CFV+R DW H V V++ + +Q Y T Sbjct: 97 LIMLAATP------CFVRREDWPHAVEVSILTQFAQDLKQNYTET 135
>BIOH_XYLFA (Q9PDM3) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +3 Query: 57 LIILAACHEHSPPCCFVKRLDWCHLVRVALEE*MSTSARQQYRTT 191 LI+LAA CFV+R DW H V V++ + +Q Y T Sbjct: 97 LIMLAATP------CFVRREDWPHAVEVSIFTQFAEDLKQNYTET 135
>MILK1_MOUSE (Q8BGT6) Molecule interacting with Rab13 (MIRab13) (MICAL-like| protein 1) Length = 870 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -3 Query: 388 SATDWNPEHLSKFHQEEKSKENPSPPQPNCAGANPI 281 S T+ P+ + F +EE+ + P+PP P+ + A P+ Sbjct: 411 SGTEPEPKPYNPFEEEEEEEGEPAPPVPSPSLAPPV 446
>TWHH_BRARE (Q90419) Tiggy-winkle hedgehog protein precursor (TWHH) (Sonic| hedgehog B protein) (SHHB) [Contains: Tiggy-winkle hedgehog protein N-product; Tiggy-winkle hedgehog protein C-product] Length = 416 Score = 28.9 bits (63), Expect = 3.0 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 239 KAPTSVASTGGFCLPGSGSVLL 174 KA SVA+ G C PGSG+V L Sbjct: 189 KAENSVAAKSGGCFPGSGTVTL 210
>RAB3C_RAT (P62824) Ras-related protein Rab-3C| Length = 227 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 346 QEEKSKENPSPPQPNC 299 Q + KE P PPQPNC Sbjct: 210 QSTRLKETPPPPQPNC 225
>RAB3C_MOUSE (P62823) Ras-related protein Rab-3C| Length = 227 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 346 QEEKSKENPSPPQPNC 299 Q + KE P PPQPNC Sbjct: 210 QSTRLKETPPPPQPNC 225
>HMSH_DROME (Q03372) Muscle segmentation homeobox (Protein drop) (Protein msh)| Length = 515 Score = 28.1 bits (61), Expect = 5.2 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 17/71 (23%) Frame = -2 Query: 251 NALEKAPTSVASTGGFCLPGSGSVLLSSTRAHLLLQCDAHQM-----------------T 123 N +P+ A P S S LL + + HLL Q HQ Sbjct: 60 NLTNLSPSHPAGLNALASPTSPSALLLAHQQHLLQQHQQHQQQQQQQQQAAALQLAAVHP 119 Query: 122 PVQSLHKTTRR 90 P LHKTT R Sbjct: 120 PAHHLHKTTSR 130
>ZN638_MOUSE (Q61464) Zinc finger protein 638 (Nuclear protein 220) (Zinc-finger| matrin-like protein) Length = 1960 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -3 Query: 379 DWNPEHLSKFHQEEKSKENPSP------PQPNCAGANPIEHR 272 DWNPE L E KEN +P P P + + HR Sbjct: 461 DWNPEILPSRRNESNRKENETPRRRSHSPSPRHSRRSSSGHR 502
>PAHO_RAT (P06303) Pancreatic prohormone precursor (Pancreatic polypeptide)| (PP) [Contains: Pancreatic hormone; C-terminal peptide] Length = 98 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 172 DSSTEPLPGRQKPPVDATLVGAFSSA 249 D T LPGRQ PP + LVG A Sbjct: 69 DEDTAGLPGRQLPPCTSLLVGLMPCA 94
>ZN638_HUMAN (Q14966) Zinc finger protein 638 (Nuclear protein 220) (Zinc-finger| matrin-like protein) (Cutaneous T-cell lymphoma-associated antigen se33-1) (CTCL tumor antigen se33-1) Length = 1978 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -3 Query: 379 DWNPEHLSKFHQEEKSKENPSP------PQPNCAGANPIEHR 272 DWNPE L E KEN +P P P + + HR Sbjct: 463 DWNPEILPSRRNEGNRKENETPRRRSHSPSPRRSRRSSSSHR 504
>ILVB_MYCTU (P0A622) Acetolactate synthase (EC 2.2.1.6) (Acetohydroxy-acid| synthase) (ALS) Length = 618 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 17 PTSLPRIHSSATDPHHPCCLPR--ALSSLLFCEA 112 PT P HS+A +P HP P+ AL L +A Sbjct: 10 PTFKPEPHSAANEPKHPAARPKHVALQQLTGAQA 43
>ILVB_MYCBO (P0A623) Acetolactate synthase (EC 2.2.1.6) (Acetohydroxy-acid| synthase) (ALS) Length = 618 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 17 PTSLPRIHSSATDPHHPCCLPR--ALSSLLFCEA 112 PT P HS+A +P HP P+ AL L +A Sbjct: 10 PTFKPEPHSAANEPKHPAARPKHVALQQLTGAQA 43
>LRP12_MACFA (Q9BE74) Low-density lipoprotein receptor-related protein 12| (Fragment) Length = 701 Score = 27.7 bits (60), Expect = 6.8 Identities = 24/82 (29%), Positives = 28/82 (34%), Gaps = 5/82 (6%) Frame = +1 Query: 172 DSSTEPLPGRQKPPVDATLV-----GAFSSAFRFQKTLICVQ*GSRLRSLVAADSGFLCS 336 DSS E + ++ P AT F RF K C L + D C Sbjct: 35 DSSDEEICAKEANPPTATAFQPCAYNQFQCLSRFTKVYTC------LAESLKCDGNIDCL 88 Query: 337 FLLGGISRDAPGSNQWLKSLSG 402 L I D P QWLK G Sbjct: 89 DLGDEIDCDVPTCGQWLKYFYG 110
>NPAS3_HUMAN (Q8IXF0) Neuronal PAS domain protein 3 (Neuronal PAS3) (Member of| PAS protein 6) (MOP6) Length = 933 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 24 LSHGYTVALQTLIILAACHEHSPPCCFVKRLDWCHL 131 LSHG TV Q + ++ H PP R+D CH+ Sbjct: 298 LSHGRTVPSQIMGLVVVAHALPPPTINEVRID-CHM 332
>EP400_HUMAN (Q96L91) E1A-binding protein p400 (EC 3.6.1.-) (p400 kDa| SWI2/SNF2-related protein) (Domino homolog) (hDomino) (CAG repeat protein 32) (Trinucleotide repeat-containing gene 12 protein) Length = 3160 Score = 27.3 bits (59), Expect = 8.8 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 400 PREISATD-WNPEHLSKFHQEEKSKENPSPPQPNCAGANP 284 P +I A PEHL K Q++K + P PP P A P Sbjct: 2804 PAQIKAVGKLTPEHLIKM-QKQKLQMPPQPPPPQAQSAPP 2842
>S12A2_SQUAC (P55013) Solute carrier family 12 member 2 (Bumetanide-sensitive| sodium-(potassium)-chloride cotransporter 1) (NA-K-CL symporter) (NKCC) Length = 1191 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 175 SSTEPLPGRQKPPVDATLVGAFSSAFRFQKTLI 273 S EP G+Q+PP AT + +S RFQ L+ Sbjct: 16 SGPEPGAGQQEPPPPATPLRPVASQSRFQVDLV 48
>PR1A_LYCES (Q08697) Pathogenesis-related protein 1A1 precursor (PR-1A1)| Length = 175 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 180 YRTTTRQAKATCRCNTGWRFL*CV*VPENSHLCSI 284 +R + R A RCN+GW F+ C P +++ ++ Sbjct: 122 WRKSVRLGCARVRCNSGWVFITCNYDPPGNYIDNV 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,090,404 Number of Sequences: 219361 Number of extensions: 1196646 Number of successful extensions: 4036 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 3856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4033 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)