| Clone Name | bastl28d06 |
|---|---|
| Clone Library Name | barley_pub |
>AMPN_HAEIN (P45274) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 34.7 bits (78), Expect = 0.059 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 233 LPKEIFLKDYKKPDYLFDTVDLEFQLGDEKTIVTS 337 L K + KDYK+PD+ + L+FQL + T+VT+ Sbjct: 2 LAKAKYRKDYKQPDFTVTDIYLDFQLDPKHTVVTA 36
>AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 34.7 bits (78), Expect = 0.059 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 236 PKEIFLKDYKKPDYLFDTVDLEFQLGDEKTIVTS 337 P+ + DY+ PDY +DL F L +KT+VT+ Sbjct: 4 PQAKYRHDYRAPDYQITDIDLTFDLDAQKTVVTA 37
>AMP1_PLAFQ (O96935) M1-family aminopeptidase (EC 3.4.11.-) (Pfa-M1)| Length = 1085 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 236 PKEIFLKDYKKPDYLFDTVDLEFQLGDEKTIVTS 337 PK + KDYK ++ + V L + D +TIV S Sbjct: 196 PKIHYRKDYKPSGFIINNVTLNINIHDNETIVRS 229
>EURM1_EURMA (P25780) Mite group 1 allergen Eur m 1 precursor (EC 3.4.22.-) (Eur| m I) Length = 321 Score = 28.9 bits (63), Expect = 3.2 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +1 Query: 106 TLDRNKVQFLVVIT*FKVCQQEDSLFDCNRATYCCSRRTRDGPSEGDI 249 +LD K QFL+ F +Q + FD N TY CS + PSE D+ Sbjct: 71 SLDEFKNQFLMNANAF---EQLKTQFDLNAETYACSINSVSLPSELDL 115
>RL5_THEVO (Q97BW3) 50S ribosomal protein L5P| Length = 170 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 233 LPKEIFLKDYKKPDYLFD 286 L K +++KDYK PDY FD Sbjct: 75 LNKALYVKDYKIPDYSFD 92
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 12 PSIKDCLSPLQRGVPQGTRTLATALI*QRRVHTGQEQGPIPC 137 P + D PL+ VP GT+ + +L + QE+ P+PC Sbjct: 1103 PGLGDTSFPLRHPVPHGTQDFSASLSIEMS-KGPQEEPPVPC 1143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,609,108 Number of Sequences: 219361 Number of extensions: 868834 Number of successful extensions: 1920 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1920 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)