| Clone Name | bastl27e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NIFS_FRASE (Q9Z5X5) Cysteine desulfurase (EC 2.8.1.7) (Nitrogena... | 32 | 0.91 | 2 | VTI13_ARATH (Q9LVP9) Vesicle transport v-SNARE 13 (AtVTI13) (Ves... | 29 | 4.5 | 3 | ACDD2_METAC (Q8TJC2) Acetyl-CoA decarbonylase/synthase complex d... | 28 | 7.7 | 4 | ACDD1_METAC (Q8TRZ8) Acetyl-CoA decarbonylase/synthase complex d... | 28 | 7.7 |
|---|
>NIFS_FRASE (Q9Z5X5) Cysteine desulfurase (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS) Length = 419 Score = 31.6 bits (70), Expect = 0.91 Identities = 25/73 (34%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 97 RPEDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDHTGRSFGTYPAVLLYRPRS 276 RP E+ AG RCC D T AL R PV + TG A LY P+ Sbjct: 166 RPLVEAARSAG------RCCCADVTQ-----ALGRVPVEFERTGVDLAVSSAHKLYGPKG 214 Query: 277 VS---LQKIKWPR 306 V K W R Sbjct: 215 VGALIASKDAWSR 227
>VTI13_ARATH (Q9LVP9) Vesicle transport v-SNARE 13 (AtVTI13) (Vesicle transport| v-SNARE protein VTI13) (Vesicle soluble NSF attachment protein receptor 13) Length = 221 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 237 ERTTSVIKSDGSPRERKACEICSGVEKAAALTR 139 ++ TS I DG +++ EI SGVE+A AL + Sbjct: 21 KKCTSAIALDGEQKKQNLSEIKSGVEEAEALVK 53
>ACDD2_METAC (Q8TJC2) Acetyl-CoA decarbonylase/synthase complex delta subunit 2| (ACDS complex delta subunit 2) (Corrinoid/iron-sulfur component small subunit 2) Length = 436 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 103 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 222 + E +++A VS +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVSEGERCLLASASLNLDYAAIAEAALKYDH 278
>ACDD1_METAC (Q8TRZ8) Acetyl-CoA decarbonylase/synthase complex delta subunit 1| (ACDS complex delta subunit 1) (Corrinoid/iron-sulfur component small subunit 1) Length = 436 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 103 EDESVSQAGLVSSRQRCCLLDSTADLTRFALARAPVRLDH 222 + E +++A VS +RC L ++ +L A+A A ++ DH Sbjct: 239 DPEVLARAAEVSEGERCLLASASLNLDYAAIAEAALKYDH 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,039,311 Number of Sequences: 219361 Number of extensions: 957958 Number of successful extensions: 2428 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2427 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)