| Clone Name | bastl27e05 |
|---|---|
| Clone Library Name | barley_pub |
>FUSC3_FUSCU (Q8J1X7) Allergen Fus c 3| Length = 450 Score = 24.6 bits (52), Expect(2) = 1.5 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 85 HHPSHPLRIWTTTDHSQRHIRHHIYSRSPLHSTLSAS 195 H PSHP + H Q H H R HS S++ Sbjct: 101 HAPSHPSHLSHGAPHEQEHA--HEIQRHRAHSAQSSA 135 Score = 23.9 bits (50), Expect(2) = 1.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 25 PRRDAGDSARRPSVHSIFLYHHPSHP 102 P R + ++ RP I +HH +HP Sbjct: 39 PNRTSRNTPLRPESTEIETHHHANHP 64
>EXBD_SYNY3 (P72942) Putative biopolymer transport exbD protein| Length = 269 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 46 SARRPSVHSIFL-YHHPSHPLRIWTTTDHSQRHIRHHI 156 S + P H F +HP+ PL +W H Q +R I Sbjct: 4 SPKAPKSHRKFQSIYHPTRPLSLWQDNQHDQGEVRIEI 41
>SUVR3_ARATH (Q9SRV2) Histone-lysine N-methyltransferase SUVR3 (EC 2.1.1.43)| (Suppressor of variegation 3-9-related protein 3) (Su(var)3-9-related protein 3) (Protein SET DOMAIN GROUP 20) Length = 338 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 214 RCLGFLDWRRVWSEVASGCRCGAVC 140 +CL F + +E SGC CG+ C Sbjct: 156 KCLAFAGMEEIANECGSGCGCGSDC 180
>ODP2_NEUCR (P20285) Dihydrolipoyllysine-residue acetyltransferase component of| pyruvate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.12) (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (PDC-E2) (MRP3) Length = 458 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 325 PVVAPRRAQGGQGTWTARPGDR 390 P ++P GG G W +PGD+ Sbjct: 40 PALSPTMTSGGIGAWQKKPGDK 61
>DYHC_SCHPO (O13290) Dynein heavy chain, cytosolic (DYHC)| Length = 4196 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +1 Query: 55 RPSVHSIFLYHHPSHPLRIWTTTDHSQRHIR--HHIYSRSPLHSTLSAS 195 RP + S++ + SHP D + HI H I + S +H+ L S Sbjct: 2813 RPKLESLYKKFYSSHPNNTLVFVDETITHILRFHRILNNSGMHALLQGS 2861
>YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II| Length = 456 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 122 VVVQMRRGWDGWWYKKM 72 V V+ +R W+GWW +K+ Sbjct: 100 VEVEEKRAWEGWWNEKI 116
>YHP6_SCHPO (Q9USP7) Protein C902.06 in chromosome II| Length = 397 Score = 27.3 bits (59), Expect = 8.9 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Frame = +1 Query: 25 PRRDAGDSARRPSVH------SIFLYHH--PSHPLRIWTTTDHSQRHIRHHIYSRSPLHS 180 P+R A DS RPS+H S+ L + H +R +D S+ H + H +S P Sbjct: 277 PQRMASDSYGRPSLHLNDPFPSVDLQSNELSHHNVRTTLFSDDSRFHSKIHTHSTPPSQM 336 Query: 181 TLSAS 195 +AS Sbjct: 337 YSAAS 341 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,267,775 Number of Sequences: 219361 Number of extensions: 540728 Number of successful extensions: 2039 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2031 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)