| Clone Name | bastl27a11 |
|---|---|
| Clone Library Name | barley_pub |
>YFK8_YEAST (P43610) Hypothetical ATP-dependent helicase YFR038W (EC 3.6.1.-)| Length = 853 Score = 72.4 bits (176), Expect = 3e-13 Identities = 34/67 (50%), Positives = 49/67 (73%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 LKP+QL+G++WLI Y G+N +L DEMGLGKT+Q+I+LL+++ + PFLV PLS Sbjct: 222 LKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAFI-YEMDTKGPFLVTAPLS 280 Query: 352 VTDGWLS 372 D W++ Sbjct: 281 TLDNWMN 287
>INO80_GIBZE (Q4IL82) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1904 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/69 (47%), Positives = 46/69 (66%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 + A LK +QL G++WL+ Y G+N +L DEMGLGKT+Q+IS+++YL K PFLV+ Sbjct: 1041 INAQLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTVQSISVMAYLAEKHDIWGPFLVV 1100 Query: 340 CPLSVTDGW 366 P S W Sbjct: 1101 APASTLHNW 1109
>SMCA5_MOUSE (Q91ZW3) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 5 (EC 3.6.1.-) (Sucrose nonfermenting protein 2 homolog) (mSnf2h) Length = 1051 Score = 70.9 bits (172), Expect = 7e-13 Identities = 34/67 (50%), Positives = 44/67 (65%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q+ G++WLI Y G+N +L DEMGLGKTLQ ISLL Y+K P P +VL P S Sbjct: 179 LRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKS 238 Query: 352 VTDGWLS 372 W+S Sbjct: 239 TLHNWMS 245
>INO80_ASPFU (Q4WTV7) Putative DNA helicase ino80 (EC 3.6.1.-)| Length = 1708 Score = 70.9 bits (172), Expect = 7e-13 Identities = 33/69 (47%), Positives = 46/69 (66%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 +TA LK +QL G++WL+ Y G+N +L DEMGLGKT+Q+IS+++YL PFLV+ Sbjct: 829 LTAKLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTIQSISVMAYLAEVHNIWGPFLVI 888 Query: 340 CPLSVTDGW 366 P S W Sbjct: 889 APASTLHNW 897
>ISW1_YEAST (P38144) Chromatin remodelling complex ATPase chain ISW1 (EC| 3.6.1.-) Length = 1129 Score = 70.9 bits (172), Expect = 7e-13 Identities = 33/70 (47%), Positives = 44/70 (62%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 V L+P+Q+ GV+WL+ + + +L DEMGLGKTLQ IS L YL+ P PFLV+ Sbjct: 192 VNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVI 251 Query: 340 CPLSVTDGWL 369 P S + WL Sbjct: 252 APKSTLNNWL 261
>SMCA5_HUMAN (O60264) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 5 (EC 3.6.1.-) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5) (Sucrose nonfermenting protein 2 homolog) (hSNF2 Length = 1052 Score = 70.9 bits (172), Expect = 7e-13 Identities = 34/67 (50%), Positives = 44/67 (65%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q+ G++WLI Y G+N +L DEMGLGKTLQ ISLL Y+K P P +VL P S Sbjct: 180 LRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKS 239 Query: 352 VTDGWLS 372 W+S Sbjct: 240 TLHNWMS 246
>INO80_EMENI (Q5BAZ5) Putative DNA helicase ino80 (EC 3.6.1.-)| Length = 1612 Score = 70.9 bits (172), Expect = 7e-13 Identities = 33/69 (47%), Positives = 46/69 (66%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 +TA LK +QL G++WL+ Y G+N +L DEMGLGKT+Q+IS+++YL PFLV+ Sbjct: 794 LTAKLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTIQSISVMAYLAEVHNIWGPFLVI 853 Query: 340 CPLSVTDGW 366 P S W Sbjct: 854 APASTLHNW 862
>SMCA1_HUMAN (P28370) Probable global transcription activator SNF2L1 (EC| 3.6.1.-) (ATP-dependent helicase SMARCA1) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 1) Length = 976 Score = 70.1 bits (170), Expect = 1e-12 Identities = 34/67 (50%), Positives = 44/67 (65%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q+ G++WLI Y GVN +L DEMGLGKTLQ I+LL YLK P P +VL P S Sbjct: 105 LRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKS 164 Query: 352 VTDGWLS 372 W++ Sbjct: 165 TLHNWMN 171
>BRM_DROME (P25439) Homeotic gene regulator (EC 3.6.1.-) (ATP-dependent| helicase brm) (Protein brahma) Length = 1638 Score = 69.3 bits (168), Expect = 2e-12 Identities = 31/77 (40%), Positives = 48/77 (62%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIA 318 + A + V LK +Q+ G+ WL+ Y+ +N +L DEMGLGKT+Q ISL++YL + Sbjct: 762 VEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKV 821 Query: 319 PRPFLVLCPLSVTDGWL 369 P+L++ PLS W+ Sbjct: 822 MGPYLIIVPLSTLPNWV 838
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 69.3 bits (168), Expect = 2e-12 Identities = 32/69 (46%), Positives = 45/69 (65%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 + LK +QL G++WL+ Y G+N +L DEMGLGKT+Q+IS+++YL K PFLV+ Sbjct: 1114 LNCQLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTVQSISVMAYLAEKYDIWGPFLVV 1173 Query: 340 CPLSVTDGW 366 P S W Sbjct: 1174 APASTLHNW 1182
>INO80_USTMA (Q4PGL2) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1910 Score = 68.9 bits (167), Expect = 3e-12 Identities = 33/69 (47%), Positives = 44/69 (63%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 +T LK +QL G++WL Y G+N +L DEMGLGKT+Q+ISL++YL PFLV+ Sbjct: 994 LTCQLKEYQLKGLNWLANLYEQGINGILADEMGLGKTVQSISLMAYLAEVHDIWGPFLVI 1053 Query: 340 CPLSVTDGW 366 P S W Sbjct: 1054 APASTLHNW 1062
>ISW2_ORYSA (Q7G8Y3) Putative chromatin remodelling complex ATPase chain (EC| 3.6.1.-) (ISW2-like) (Sucrose nonfermenting protein 2 homolog) Length = 1107 Score = 67.8 bits (164), Expect = 6e-12 Identities = 35/78 (44%), Positives = 46/78 (58%) Frame = +1 Query: 136 RLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSI 315 RL S + ++ +QL G++WLIR Y G+N +L DEMGLGKTLQ ISLL YL Sbjct: 219 RLLSQPSCIKGKMRDYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLGYLHEFRG 278 Query: 316 APRPFLVLCPLSVTDGWL 369 P +V+ P S W+ Sbjct: 279 ITGPHMVVAPKSTLGNWI 296
>ISW2_ARATH (Q8RWY3) Putative chromatin remodelling complex ATPase chain (EC| 3.6.1.-) (ISW2-like) (Sucrose nonfermenting protein 2 homolog) Length = 1057 Score = 67.4 bits (163), Expect = 8e-12 Identities = 34/79 (43%), Positives = 48/79 (60%) Frame = +1 Query: 136 RLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSI 315 RL + + ++ +QL G++WLIR Y G+N +L DEMGLGKTLQ ISLL+YL Sbjct: 177 RLLTQPSCIQGKMRDYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLAYLHEYRG 236 Query: 316 APRPFLVLCPLSVTDGWLS 372 P +V+ P S W++ Sbjct: 237 INGPHMVVAPKSTLGNWMN 255
>INO80_CRYNE (Q5KHM0) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1765 Score = 67.4 bits (163), Expect = 8e-12 Identities = 34/67 (50%), Positives = 42/67 (62%) Frame = +1 Query: 166 ADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCP 345 A LK +QL G+ WL Y G+N +L DEMGLGKT+Q+ISLL+YL PFLV+ P Sbjct: 869 AQLKEYQLKGLTWLGNLYEQGINGILADEMGLGKTIQSISLLAYLAEHHNLWGPFLVIAP 928 Query: 346 LSVTDGW 366 S W Sbjct: 929 ASTLHNW 935 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVH-----WLIRRYHLGVNVLLGDEM 255 + S+ GVT +LKP QL +H +++RR V LGD++ Sbjct: 1071 IESSSGGVTGNLKPEQLKRLHMILKPFMLRRVKKHVQKELGDKI 1114
>ISWI_DROME (Q24368) Chromatin remodelling complex ATPase chain Iswi (EC| 3.6.1.-) (Protein imitation swi) (Nucleosome remodeling factor 140 kDa subunit) (NURF-140) (CHRAC 140 kDa subunit) Length = 1027 Score = 66.6 bits (161), Expect = 1e-11 Identities = 30/70 (42%), Positives = 45/70 (64%) Frame = +1 Query: 163 TADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLC 342 + +++ +Q+ G++W+I Y G+N +L DEMGLGKTLQ ISLL YLK P +V+ Sbjct: 125 SGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIV 184 Query: 343 PLSVTDGWLS 372 P S W++ Sbjct: 185 PKSTLQNWVN 194
>SMCA4_HUMAN (P51532) Probable global transcription activator SNF2L4 (EC| 3.6.1.-) (ATP-dependent helicase SMARCA4) (SNF2-beta) (BRG-1 protein) (Mitotic growth and transcription activator) (Brahma protein homolog 1) (SWI/SNF-related matrix-associated actin Length = 1647 Score = 66.2 bits (160), Expect = 2e-11 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = +1 Query: 154 LGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFL 333 L V LK +Q+ G+ WL+ Y+ +N +L DEMGLGKT+Q I+L++YL PFL Sbjct: 748 LMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFL 807 Query: 334 VLCPLSVTDGW 366 ++ PLS W Sbjct: 808 IIVPLSTLSNW 818
>SNF22_SCHPO (O94421) SNF2-family ATP dependent chromatin remodeling factor snf22| (EC 3.6.1.-) (ATP-dependent helicase snf22) Length = 1680 Score = 66.2 bits (160), Expect = 2e-11 Identities = 30/70 (42%), Positives = 44/70 (62%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 V LK +QL G+ W++ Y+ +N +L DEMGLGKT+Q I+ ++YL K PFL++ Sbjct: 865 VGGTLKDYQLKGLEWMLSLYNNNLNGILADEMGLGKTIQTIAFITYLIEKKNQQGPFLII 924 Query: 340 CPLSVTDGWL 369 PLS W+ Sbjct: 925 VPLSTLTNWI 934
>SNF21_SCHPO (Q9UTN6) SNF2-family ATP dependent chromatin remodeling factor| snf21 (EC 3.6.1.-) (ATP-dependent helicase snf21) Length = 1199 Score = 65.9 bits (159), Expect = 2e-11 Identities = 33/69 (47%), Positives = 44/69 (63%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 V LK +QL G+ W+I Y+ +N +L DEMGLGKT+Q ISL+++L K PFLV+ Sbjct: 413 VGGKLKEYQLRGLQWMISLYNNHLNGILADEMGLGKTIQTISLITHLIEKKRQNGPFLVI 472 Query: 340 CPLSVTDGW 366 PLS W Sbjct: 473 VPLSTLTNW 481
>INO80_DEBHA (Q6BGY8) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1364 Score = 65.5 bits (158), Expect = 3e-11 Identities = 34/76 (44%), Positives = 47/76 (61%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIA 318 +S DL + LK +Q+ G++WL Y G+N +L DEMGLGKT+Q+IS+L+YL Sbjct: 557 ISQPDL-LKCTLKEYQVKGLNWLANLYEQGINGILADEMGLGKTVQSISVLAYLAETHNI 615 Query: 319 PRPFLVLCPLSVTDGW 366 PFLV+ P S W Sbjct: 616 WGPFLVVTPASTLHNW 631
>INO80_CANAL (Q59KI4) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1387 Score = 65.5 bits (158), Expect = 3e-11 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 LK +QL G++WL Y G+N +L DEMGLGKT+Q+IS+L+YL PFLV+ P S Sbjct: 672 LKEYQLKGLNWLANLYEQGINGILADEMGLGKTVQSISVLAYLAETYNMWGPFLVVTPAS 731 Query: 352 VTDGW 366 W Sbjct: 732 TLHNW 736
>SMCA2_HUMAN (P51531) Probable global transcription activator SNF2L2 (EC| 3.6.1.-) (ATP-dependent helicase SMARCA2) (SNF2-alpha) (SWI/SNF-related matrix associated actin dependent regulator of chromatin subfamily A member 2) (hBRM) Length = 1586 Score = 65.1 bits (157), Expect = 4e-11 Identities = 28/69 (40%), Positives = 43/69 (62%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 + LK +QL G+ W++ Y+ +N +L DEMGLGKT+Q I+L++YL P+L++ Sbjct: 716 INGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLII 775 Query: 340 CPLSVTDGW 366 PLS W Sbjct: 776 VPLSTLSNW 784
>STH1_YEAST (P32597) Nuclear protein STH1/NPS1 (EC 3.6.1.-) (ATP-dependent| helicase STH1) (Chromatin structure remodeling complex protein STH1) (SNF2 homolog) Length = 1359 Score = 64.7 bits (156), Expect = 5e-11 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 V LK +QL G+ W++ Y+ +N +L DEMGLGKT+Q+ISL++YL PFLV+ Sbjct: 466 VGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVI 525 Query: 340 CPLSVTDGW 366 PLS W Sbjct: 526 VPLSTITNW 534
>INO80_YEAST (P53115) Putative DNA helicase INO80 (EC 3.6.1.-)| (Inositol-requiering protein 80) Length = 1489 Score = 64.7 bits (156), Expect = 5e-11 Identities = 31/67 (46%), Positives = 44/67 (65%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 LK +QL G++WL Y G+N +L DEMGLGKT+Q+IS+L++L PFLV+ P S Sbjct: 706 LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHNIWGPFLVVTPAS 765 Query: 352 VTDGWLS 372 W++ Sbjct: 766 TLHNWVN 772
>INO80_CANGA (Q6FV37) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1484 Score = 64.3 bits (155), Expect = 7e-11 Identities = 31/67 (46%), Positives = 44/67 (65%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 LK +QL G++WL Y G+N +L DEMGLGKT+Q+IS+L++L PFLV+ P S Sbjct: 722 LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEHHNIWGPFLVVTPAS 781 Query: 352 VTDGWLS 372 W++ Sbjct: 782 TLHNWVN 788
>SNF2_YEAST (P22082) Transcription regulatory protein SNF2 (EC 3.6.1.-)| (ATP-dependent helicase SNF2) (SWI/SNF complex component SNF2) (Regulatory protein SWI2) (Regulatory protein GAM1) (Transcription factor TYE3) Length = 1703 Score = 64.3 bits (155), Expect = 7e-11 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 V LK +Q+ G+ W++ ++ +N +L DEMGLGKT+Q ISLL+YL P+LV+ Sbjct: 763 VGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVI 822 Query: 340 CPLSVTDGWLS 372 PLS W S Sbjct: 823 VPLSTLSNWSS 833
>INO80_ASHGO (Q74Z27) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1414 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/67 (44%), Positives = 45/67 (67%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 LK +QL G++WL Y G+N +L DEMGLGKT+Q+IS+L++L + PF+V+ P S Sbjct: 655 LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAERYNIWGPFIVVTPAS 714 Query: 352 VTDGWLS 372 W++ Sbjct: 715 TLHNWVN 721
>SWR1_DEBHA (Q6BKC2) Helicase SWR1 (EC 3.6.1.-)| Length = 1616 Score = 64.3 bits (155), Expect = 7e-11 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+P+Q G++WL Y+ G N +L DEMGLGKT+Q ISLL+YL + P L++ P S Sbjct: 781 LRPYQKQGLNWLASLYNNGTNGILADEMGLGKTIQTISLLAYLAAEHHIWGPHLIVVPTS 840 Query: 352 VTDGW 366 V W Sbjct: 841 VMLNW 845
>INO80_KLULA (Q6CNY4) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1489 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/67 (44%), Positives = 45/67 (67%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 LK +QL G++WL Y G+N +L DEMGLGKT+Q+IS+L++L + PF+V+ P S Sbjct: 746 LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLADRYNIWGPFIVVTPAS 805 Query: 352 VTDGWLS 372 W++ Sbjct: 806 TLHNWVN 812
>CHD2_HUMAN (O14647) Chromodomain-helicase-DNA-binding protein 2 (EC 3.6.1.-)| (ATP-dependent helicase CHD2) (CHD-2) Length = 1739 Score = 63.9 bits (154), Expect = 9e-11 Identities = 31/70 (44%), Positives = 44/70 (62%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G +L+ +QL+G++WL + +V+L DEMGLGKT+Q IS LSYL + PFL+ Sbjct: 479 GENLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLI 538 Query: 337 LCPLSVTDGW 366 + PLS W Sbjct: 539 VVPLSTLTSW 548
>HRP3_SCHPO (O14139) Chromodomain helicase hrp3 (EC 3.6.1.-) (ATP-dependent| helicase hrp3) Length = 1388 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/66 (45%), Positives = 40/66 (60%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +L+ QL GV+W+ +H N +L DEMGLGKT+Q ++ LSYL PFLV+ PL Sbjct: 374 ELRDFQLTGVNWMAYLWHKNENGILADEMGLGKTVQTVAFLSYLAHSLRQHGPFLVVVPL 433 Query: 349 SVTDGW 366 S W Sbjct: 434 STVPAW 439
>SWR1_CANAL (Q59U81) Helicase SWR1 (EC 3.6.1.-)| Length = 1641 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+P+Q G++WL Y+ N +L DEMGLGKT+Q ISLL+YL + P L++ P S Sbjct: 823 LRPYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEHHKWGPHLIIVPTS 882 Query: 352 VTDGW 366 V W Sbjct: 883 VMLNW 887
>SMRCD_MOUSE (Q04692) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A containing DEAD/H box 1 (EC 3.6.1.-) (ATP-dependent helicase SMARCAD1) (Enhancer trap locus homolog 1) (Etl-1) Length = 1021 Score = 61.6 bits (148), Expect = 4e-10 Identities = 32/72 (44%), Positives = 45/72 (62%) Frame = +1 Query: 154 LGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFL 333 L + LKP+Q G++WL + G+N +L DEMGLGKT+QAI+ L+YL + P L Sbjct: 486 LNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYL-FQEGNKGPHL 544 Query: 334 VLCPLSVTDGWL 369 ++ P S D WL Sbjct: 545 IVVPASTIDNWL 556
>CHD6_HUMAN (Q8TD26) Chromodomain-helicase-DNA-binding protein 6 (EC 3.6.1.-)| (ATP-dependent helicase CHD6) (CHD-6) (Radiation-induced gene B protein) Length = 2715 Score = 60.8 bits (146), Expect = 8e-10 Identities = 28/65 (43%), Positives = 45/65 (69%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +QL+G++WL+ ++ N +L DEMGLGKT+Q+I+ LS + ++ I PFL++ PLS Sbjct: 461 LREYQLEGMNWLLFNWYNRKNCILADEMGLGKTIQSITFLSEIFLRGI-HGPFLIIAPLS 519 Query: 352 VTDGW 366 W Sbjct: 520 TITNW 524
>CHD7_HUMAN (Q9P2D1) Chromodomain-helicase-DNA-binding protein 7 (EC 3.6.1.-)| (ATP-dependent helicase CHD7) (CHD-7) (Fragment) Length = 2235 Score = 60.8 bits (146), Expect = 8e-10 Identities = 30/65 (46%), Positives = 44/65 (67%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +QL+GV+WL+ ++ N +L DEMGLGKT+Q+I+ L + +K I PFLV+ PLS Sbjct: 206 LREYQLEGVNWLLFNWYNMRNCILADEMGLGKTIQSITFLYEIYLKGI-HGPFLVIAPLS 264 Query: 352 VTDGW 366 W Sbjct: 265 TIPNW 269
>SWR1_USTMA (Q4P328) Helicase SWR1 (EC 3.6.1.-)| Length = 1830 Score = 60.8 bits (146), Expect = 8e-10 Identities = 32/65 (49%), Positives = 39/65 (60%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+P+Q G WL Y GVN +L DEMGLGKT+Q ISLL++L P LV+ P S Sbjct: 990 LRPYQQIGFEWLCSLYANGVNGILADEMGLGKTIQTISLLAHLACDKGVWGPHLVVAPTS 1049 Query: 352 VTDGW 366 V W Sbjct: 1050 VMLNW 1054
>CHD1_MOUSE (P40201) Chromodomain-helicase-DNA-binding protein 1 (EC 3.6.1.-)| (ATP-dependent helicase CHD1) (CHD-1) Length = 1711 Score = 60.8 bits (146), Expect = 8e-10 Identities = 29/66 (43%), Positives = 43/66 (65%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +L+ +QL+G++WL + G + +L DEMGLGKT+Q IS L+YL + PFL++ PL Sbjct: 478 ELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPL 537 Query: 349 SVTDGW 366 S W Sbjct: 538 STLTSW 543
>SMRCD_HUMAN (Q9H4L7) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A containing DEAD/H box 1 (EC 3.6.1.-) (ATP-dependent helicase 1) (hHEL1) Length = 1026 Score = 60.8 bits (146), Expect = 8e-10 Identities = 32/72 (44%), Positives = 45/72 (62%) Frame = +1 Query: 154 LGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFL 333 L + LKP+Q G++WL + G+N +L DEMGLGKT+QAI+ L+YL + P L Sbjct: 491 LNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYL-YQEGNNGPHL 549 Query: 334 VLCPLSVTDGWL 369 ++ P S D WL Sbjct: 550 IVVPASTIDNWL 561
>CHD1_HUMAN (O14646) Chromodomain-helicase-DNA-binding protein 1 (EC 3.6.1.-)| (ATP-dependent helicase CHD1) (CHD-1) Length = 1709 Score = 60.8 bits (146), Expect = 8e-10 Identities = 29/66 (43%), Positives = 43/66 (65%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +L+ +QL+G++WL + G + +L DEMGLGKT+Q IS L+YL + PFL++ PL Sbjct: 480 ELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPL 539 Query: 349 SVTDGW 366 S W Sbjct: 540 STLTSW 545
>SWR1_YEAST (Q05471) Helicase SWR1 (EC 3.6.1.-) (Swi2/Snf2-related 1)| Length = 1514 Score = 60.5 bits (145), Expect = 1e-09 Identities = 35/86 (40%), Positives = 50/86 (58%), Gaps = 4/86 (4%) Frame = +1 Query: 121 KSQLPRLSSADLGVTA----DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISL 288 K Q +LS D+ V + +L+ +Q G++WL Y+ N +L DEMGLGKT+Q ISL Sbjct: 675 KVQEEQLSVVDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISL 734 Query: 289 LSYLKIKSIAPRPFLVLCPLSVTDGW 366 L+YL + P L++ P SV W Sbjct: 735 LAYLACEKENWGPHLIVVPTSVLLNW 760
>HRP1_SCHPO (Q9US25) Chromodomain helicase hrp1 (EC 3.6.1.-) (ATP-dependent| helicase hrp1) Length = 1373 Score = 60.1 bits (144), Expect = 1e-09 Identities = 27/66 (40%), Positives = 39/66 (59%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +++ QL G++W+ +H N +L DEMGLGKT+Q + LSYL PFL++ PL Sbjct: 389 EIRDFQLTGINWMAYLWHRNENGILADEMGLGKTVQTVCFLSYLVHSLKQHGPFLIVVPL 448 Query: 349 SVTDGW 366 S W Sbjct: 449 STVPAW 454
>ISW1_CAEEL (P41877) Chromatin remodelling complex ATPase chain isw-1 (EC| 3.6.1.-) Length = 1009 Score = 60.1 bits (144), Expect = 1e-09 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +++ +Q+ G++WL H +N +L DEMGLGKTLQ IS++ Y+K P LV+ P Sbjct: 131 EMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPK 190 Query: 349 SVTDGW 366 S W Sbjct: 191 STLQNW 196
>SWR1_CANGA (Q6FK48) Helicase SWR1 (EC 3.6.1.-)| Length = 1450 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G++WL Y+ N +L DEMGLGKT+Q ISLLSYL + P L++ P S Sbjct: 628 LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNWGPHLIVVPTS 687 Query: 352 VTDGW 366 V W Sbjct: 688 VLLNW 692
>CHDM_DROME (O97159) Chromodomain helicase-DNA-binding protein Mi-2 homolog (EC| 3.6.1.-) (ATP-dependent helicase Mi-2) (dMi-2) Length = 1982 Score = 60.1 bits (144), Expect = 1e-09 Identities = 28/70 (40%), Positives = 41/70 (58%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G L P+Q++G++WL + G++ +L DEMGLGKT+Q ++ L L + PFLV Sbjct: 725 GTGMQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLV 784 Query: 337 LCPLSVTDGW 366 PLS W Sbjct: 785 AVPLSTLVNW 794
>SWR1_ASHGO (Q759G7) Helicase SWR1 (EC 3.6.1.-)| Length = 1486 Score = 59.7 bits (143), Expect = 2e-09 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (4%) Frame = +1 Query: 124 SQLPRLSSADLGVT----ADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLL 291 + L +LS D+ V L+ +Q G++WL Y+ N +L DEMGLGKT+Q I+LL Sbjct: 651 TNLEKLSVVDVPVPPLLRGTLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALL 710 Query: 292 SYLKIKSIAPRPFLVLCPLSVTDGW 366 +YL + P L++ P SV W Sbjct: 711 AYLACEKENWGPHLIIVPTSVLLNW 735
>CHD3_CAEEL (Q22516) Chromodomain helicase-DNA-binding protein 3 homolog| (CHD-3) Length = 1787 Score = 59.3 bits (142), Expect = 2e-09 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +L P+QL+G++WL + G + +L DEMGLGKT+Q+++ L L + PFL+ PL Sbjct: 615 NLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPL 674 Query: 349 SVTDGW 366 S W Sbjct: 675 STIINW 680
>YAB9_YEAST (P31380) Hypothetical 128.5 kDa ATP-dependent helicase in ATS1-TPD3| intergenic region (EC 3.6.1.-) Length = 1131 Score = 58.5 bits (140), Expect = 4e-09 Identities = 33/79 (41%), Positives = 46/79 (58%) Frame = +1 Query: 133 PRLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKS 312 PRL S ++ LK +Q G++WL Y ++ +L D+MGLGKT Q IS +YLK + Sbjct: 563 PRLLSPEIS----LKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLK-QI 617 Query: 313 IAPRPFLVLCPLSVTDGWL 369 P P LV+ P S + WL Sbjct: 618 NEPGPHLVVVPSSTLENWL 636
>SWR1_YARLI (Q6CA87) Helicase SWR1 (EC 3.6.1.-)| Length = 1772 Score = 57.8 bits (138), Expect = 6e-09 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G+ WL Y+ N +L DEMGLGKT+Q ISLLSYL + P L++ P S Sbjct: 909 LRAYQQLGLEWLAGLYNNDTNGILADEMGLGKTIQTISLLSYLACEHHIWGPHLIIVPTS 968 Query: 352 VTDGW 366 V W Sbjct: 969 VMLNW 973
>SWR1_KLULA (Q6CJ38) Helicase SWR1 (EC 3.6.1.-)| Length = 1572 Score = 57.4 bits (137), Expect = 8e-09 Identities = 29/65 (44%), Positives = 40/65 (61%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G++WL Y+ N +L DEMGLGKT+Q ISLL+YL + P L++ P S Sbjct: 765 LRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTS 824 Query: 352 VTDGW 366 V W Sbjct: 825 VLLNW 829
>CHD9_MOUSE (Q8BYH8) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein) (PPAR-alpha-interacting complex protein 320 kDa) Length = 2885 Score = 57.4 bits (137), Expect = 8e-09 Identities = 27/65 (41%), Positives = 43/65 (66%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +QL+G++WL+ ++ N +L DEMGLGKT+Q+I+ L + + I PFL++ PLS Sbjct: 859 LREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIR-GPFLIIAPLS 917 Query: 352 VTDGW 366 W Sbjct: 918 TIANW 922
>CHD9_HUMAN (Q3L8U1) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Chromatin-related mesenchymal modulator) (CReMM) (Chromatin remodeling factor CHROM1) (Peroxisomal proliferator-activated receptor A-inter Length = 2897 Score = 57.4 bits (137), Expect = 8e-09 Identities = 27/65 (41%), Positives = 43/65 (66%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +QL+G++WL+ ++ N +L DEMGLGKT+Q+I+ L + + I PFL++ PLS Sbjct: 860 LREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIR-GPFLIIAPLS 918 Query: 352 VTDGW 366 W Sbjct: 919 TIANW 923
>CHD8_HUMAN (Q9HCK8) Chromodomain-helicase-DNA-binding protein 8 (EC 3.6.1.-)| (ATP-dependent helicase CHD8) (CHD-8) (Helicase with SNF2 domain 1) Length = 2302 Score = 57.4 bits (137), Expect = 8e-09 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +QL+GV+WL+ ++ N +L DEMGLGKT+Q+I+ L + I PFLV+ PLS Sbjct: 532 LREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQEVYNVGI-HGPFLVIAPLS 590 Query: 352 VTDGW 366 W Sbjct: 591 TITNW 595
>MOT1_YEAST (P32333) TATA-binding protein-associated factor MOT1 (EC 3.6.1.-)| (TBP-associated factor MOT1) (Modifier of transcription 1) Length = 1867 Score = 56.6 bits (135), Expect = 1e-08 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 13/84 (15%) Frame = +1 Query: 154 LGVTADLKPHQLDGVHWL--IRRYHLGVNVLLGDEMGLGKTLQAISLLS---------YL 300 + + A L+ +Q DGV+WL + +YHL + +L D+MGLGKTLQ I +++ Y Sbjct: 1266 IAIKATLRKYQQDGVNWLAFLNKYHL--HGILCDDMGLGKTLQTICIIASDQYLRKEDYE 1323 Query: 301 KIKSIAPR--PFLVLCPLSVTDGW 366 K +S+ R P L++CP S+T W Sbjct: 1324 KTRSVESRALPSLIICPPSLTGHW 1347
>SWR1_GIBZE (Q4IAK7) Helicase SWR1 (EC 3.6.1.-)| Length = 1691 Score = 56.2 bits (134), Expect = 2e-08 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q DG+ WL Y N +L DEMGLGKT+Q I+LL++L P LV+ P S Sbjct: 811 LREYQRDGLDWLAGLYANSTNGILADEMGLGKTIQTIALLAHLACTHEVWGPHLVIVPTS 870 Query: 352 VTDGW 366 V W Sbjct: 871 VMLNW 875
>SWR1_ASPFU (Q4WAS9) Helicase swr1 (EC 3.6.1.-)| Length = 1695 Score = 55.8 bits (133), Expect = 2e-08 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G+ WL Y+ +N +L DEMGLGKT+Q I+LL++L ++ P LV+ P S Sbjct: 830 LREYQHYGLDWLAGLYNNHINGILADEMGLGKTIQTIALLAHLAVEHEVWGPHLVVVPTS 889 Query: 352 VTDGW 366 V W Sbjct: 890 VILNW 894
>CHD5_HUMAN (Q8TDI0) Chromodomain helicase-DNA-binding protein 5 (EC 3.6.1.-)| (ATP-dependent helicase CHD5) (CHD-5) Length = 1954 Score = 55.8 bits (133), Expect = 2e-08 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L P+QL+G++WL + G + +L DEMGLGKT+Q I L L + + P+LV PLS Sbjct: 700 LHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLS 759 Query: 352 VTDGW 366 W Sbjct: 760 TIINW 764
>CHD1_YEAST (P32657) Chromo domain protein 1 (EC 3.6.1.-) (ATP-dependent| helicase CHD1) Length = 1468 Score = 55.5 bits (132), Expect = 3e-08 Identities = 25/67 (37%), Positives = 40/67 (59%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPL 348 +L+ QL G++W+ + G N +L DEMGLGKT+Q ++ +S+L P +++ PL Sbjct: 375 ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPL 434 Query: 349 SVTDGWL 369 S WL Sbjct: 435 STMPAWL 441
>YFC1_SCHPO (O42861) Probable ATP-dependent helicase C25A8.01c in chromosome I| (EC 3.6.1.-) Length = 922 Score = 55.1 bits (131), Expect = 4e-08 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q+ G++WL Y L + +L DEMGLGKT Q I+ S L K+I P LV+ P S Sbjct: 387 LQDYQIIGINWLYLLYELKLAGILADEMGLGKTCQTIAFFSLLMDKNI-NGPHLVIAPAS 445 Query: 352 VTDGWL 369 + WL Sbjct: 446 TMENWL 451
>SWR1_EMENI (Q5ARK3) Helicase swr1 (EC 3.6.1.-)| Length = 1656 Score = 54.7 bits (130), Expect = 5e-08 Identities = 28/65 (43%), Positives = 40/65 (61%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G+ WL Y +N +L DEMGLGKT+Q I+LL++L ++ P LV+ P S Sbjct: 783 LREYQHFGLDWLAGLYSNHINGILADEMGLGKTIQTIALLAHLAVEHGVWGPHLVVVPTS 842 Query: 352 VTDGW 366 V W Sbjct: 843 VILNW 847
>CHD3_DROME (O16102) Chromodomain helicase-DNA-binding protein 3 (EC 3.6.1.-)| (ATP-dependent helicase Chd3) Length = 892 Score = 54.7 bits (130), Expect = 5e-08 Identities = 27/65 (41%), Positives = 36/65 (55%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L P Q++GV WL + G+ +L DEMGLGKT+Q + L L + PFL+ PLS Sbjct: 267 LHPFQIEGVSWLRYSWGQGIPTILADEMGLGKTIQTVVFLYSLFKEGHCRGPFLISVPLS 326 Query: 352 VTDGW 366 W Sbjct: 327 TLTNW 331
>CHD4_HUMAN (Q14839) Chromodomain helicase-DNA-binding protein 4 (EC 3.6.1.-)| (ATP-dependent helicase CHD4) (CHD-4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta) Length = 1912 Score = 54.3 bits (129), Expect = 7e-08 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L P+Q++G++WL + G + +L DEMGLGKT+Q L L + + PFLV PLS Sbjct: 726 LHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLS 785 Query: 352 VTDGW 366 W Sbjct: 786 TIINW 790
>CHD4_MOUSE (Q6PDQ2) Chromodomain helicase-DNA-binding protein 4 (CHD-4)| Length = 1915 Score = 54.3 bits (129), Expect = 7e-08 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L P+Q++G++WL + G + +L DEMGLGKT+Q L L + + PFLV PLS Sbjct: 719 LHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLS 778 Query: 352 VTDGW 366 W Sbjct: 779 TIINW 783
>CHD3_HUMAN (Q12873) Chromodomain helicase-DNA-binding protein 3 (EC 3.6.1.-)| (ATP-dependent helicase CHD3) (CHD-3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc-finger helicase) (hZFH) Length = 2000 Score = 54.3 bits (129), Expect = 7e-08 Identities = 32/78 (41%), Positives = 42/78 (53%) Frame = +1 Query: 133 PRLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKS 312 PR +A G L +QL+G++WL + G + +L DEMGLGKT+Q I L L + Sbjct: 726 PRFITATGGT---LHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKEG 782 Query: 313 IAPRPFLVLCPLSVTDGW 366 PFLV PLS W Sbjct: 783 HTKGPFLVSAPLSTIINW 800
>PKL_ARATH (Q9S775) CHD3-type chromatin remodeling factor PICKLE (EC 3.6.1.-)| (Protein GYMNOS) Length = 1384 Score = 53.5 bits (127), Expect = 1e-07 Identities = 28/65 (43%), Positives = 44/65 (67%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L P+QL+G+++L + +V+L DEMGLGKT+Q+I+LL+ L +++ P LV+ PLS Sbjct: 273 LHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIALLASLFEENLIPH--LVIAPLS 330 Query: 352 VTDGW 366 W Sbjct: 331 TLRNW 335
>BTAF1_HUMAN (O14981) TATA-binding protein-associated factor 172 (EC 3.6.1.-)| (ATP-dependent helicase BTAF1) (TBP-associated factor 172) (TAF-172) (TAF(II)170) (B-TFIID transcription factor-associated 170 kDa subunit) Length = 1849 Score = 53.1 bits (126), Expect = 2e-07 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 11/81 (13%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLL-----------SYLKI 306 + A+L+ +Q DGV+WL ++ +L D+MGLGKTLQ+I +L + K+ Sbjct: 1262 INAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKL 1321 Query: 307 KSIAPRPFLVLCPLSVTDGWL 369 P P LV+CP ++T W+ Sbjct: 1322 AECMPLPSLVVCPPTLTGHWV 1342
>SWR1_NEUCR (Q7S133) Helicase swr-1 (EC 3.6.1.-)| Length = 1845 Score = 53.1 bits (126), Expect = 2e-07 Identities = 28/65 (43%), Positives = 37/65 (56%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G+ WL Y N +L DEMGLGKT+Q I+LL++L P LV+ P S Sbjct: 945 LREYQHHGLDWLAGLYANNTNGILADEMGLGKTIQTIALLAHLACHHEVWGPHLVIVPTS 1004 Query: 352 VTDGW 366 V W Sbjct: 1005 VMLNW 1009
>SWR1_SCHPO (O13682) Helicase swr1 (EC 3.6.1.-)| Length = 1288 Score = 52.4 bits (124), Expect = 3e-07 Identities = 26/65 (40%), Positives = 38/65 (58%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q G+ WL + N +L DEMGLGKT+Q I+LL++L + P L++ P S Sbjct: 447 LREYQQYGLEWLTALHDSNTNGILADEMGLGKTIQTIALLAHLACEKENWGPHLIIVPTS 506 Query: 352 VTDGW 366 V W Sbjct: 507 VMLNW 511
>RAD16_YEAST (P31244) DNA repair protein RAD16 (EC 3.6.1.-) (ATP-dependent| helicase RAD16) Length = 790 Score = 52.4 bits (124), Expect = 3e-07 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = +1 Query: 130 LPRLSSADLGVTADLKPHQLDGVHWLI-RRYHLGVNVLLGDEMGLGKTLQAISLLSYLKI 306 +P+ S G+T L P QL+G+HWLI + + +L DEMG+GKT+Q I+LL + Sbjct: 170 VPQRSKQPDGMTIKLLPFQLEGLHWLISQEESIYAGGVLADEMGMGKTIQTIALL----M 225 Query: 307 KSIAPRPFLVLCPLSVTDGW 366 + P LV+ P W Sbjct: 226 NDLTKSPSLVVAPTVALMQW 245
>SMAL1_CAEEL (Q8MNV7) Putative SMARCAL1-like protein (EC 3.6.1.-)| Length = 690 Score = 52.0 bits (123), Expect = 4e-07 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 6/84 (7%) Frame = +1 Query: 133 PRLSSADLGVTAD------LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLS 294 P+ + +DL D L P+Q +GV + + R +LL DEMGLGK++QA+++ Sbjct: 181 PKAAPSDLNTVMDPSLIERLFPYQKEGVIFALER---DGRILLADEMGLGKSVQALTIAR 237 Query: 295 YLKIKSIAPRPFLVLCPLSVTDGW 366 Y K A P L++CP SV W Sbjct: 238 YYK----ADWPLLIVCPASVKGAW 257
>SWR1_CRYNE (Q5K8T2) Helicase SWR1 (EC 3.6.1.-)| Length = 1246 Score = 52.0 bits (123), Expect = 4e-07 Identities = 26/65 (40%), Positives = 37/65 (56%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+P+Q G+ WL + +N +L DEMGLGKT+Q I+LL +L L++ P S Sbjct: 393 LRPYQQAGLEWLASLWSNNMNGILADEMGLGKTIQTIALLGHLACDKGVWGQHLIIVPTS 452 Query: 352 VTDGW 366 V W Sbjct: 453 VILNW 457
>RAD26_YEAST (P40352) DNA repair and recombination protein RAD26 (EC 3.6.1.-)| (ATP-dependent helicase RAD26) Length = 1085 Score = 51.6 bits (122), Expect = 5e-07 Identities = 23/62 (37%), Positives = 34/62 (54%) Frame = +1 Query: 181 HQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLSVTD 360 +Q V WL Y ++GDEMGLGKT+Q I+ ++ L + P L++CP +V Sbjct: 300 YQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPATVMK 359 Query: 361 GW 366 W Sbjct: 360 QW 361
>ERCC6_HUMAN (Q03468) DNA excision repair protein ERCC-6 (EC 3.6.1.-)| (ATP-dependent helicase ERCC6) (Cockayne syndrome protein CSB) Length = 1493 Score = 47.0 bits (110), Expect = 1e-05 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 10/73 (13%) Frame = +1 Query: 181 HQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPR----------PF 330 +Q GV WL + +LGDEMGLGKT+Q I+ L+ L I R P Sbjct: 510 YQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIAFLAGLSYSKIRTRGSNYRFEGLGPT 569 Query: 331 LVLCPLSVTDGWL 369 +++CP +V W+ Sbjct: 570 VIVCPTTVMHQWV 582
>MOT1_SCHPO (O43065) Probable helicase mot1 (EC 3.6.1.-) (TBP-associated factor| mot1) (Modifier of transcription 1) Length = 1953 Score = 46.6 bits (109), Expect = 1e-05 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 11/85 (12%) Frame = +1 Query: 145 SADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLS---YLKIK-- 309 S + ++ADL+ +Q +GV+WL ++ +L D+MGLGKTLQ I +++ Y + K Sbjct: 1349 SIPVPISADLRKYQQEGVNWLAFLNKYELHGILCDDMGLGKTLQTICIVASDHYNRQKLF 1408 Query: 310 ------SIAPRPFLVLCPLSVTDGW 366 A P L++CP ++ W Sbjct: 1409 EESGSPKFAHVPSLIVCPSTLAGHW 1433
>SMAL1_HUMAN (Q9NZC9) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A-like protein 1 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 1) (HepA-related protein) (hHARP) Length = 954 Score = 46.2 bits (108), Expect = 2e-05 Identities = 29/76 (38%), Positives = 43/76 (56%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIA 318 LS D + ++L P Q GV++ I + G +LL D+MGLGKT+QAI + ++ + Sbjct: 425 LSEVDPKLVSNLMPFQRAGVNFAIAK---GGRLLLADDMGLGKTIQAICIAAFYR----K 477 Query: 319 PRPFLVLCPLSVTDGW 366 P LV+ P SV W Sbjct: 478 EWPLLVVVPSSVRFTW 493
>GTA_NPVAC (P41447) Probable global transactivator (EC 3.6.1.-) (ATP-dependent| helicase GTA) Length = 506 Score = 46.2 bits (108), Expect = 2e-05 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 5/75 (6%) Frame = +1 Query: 163 TADLKPHQLDGVHWLIRRYHLGV--NVLLGDEMGLGKTLQAISLL---SYLKIKSIAPRP 327 T +L HQ G+ W+I R G +L D+MGLGKTL + L+ + L++K+ Sbjct: 27 TPNLLAHQKKGIQWMINREKNGRPNGGVLADDMGLGKTLSVLMLIAKNNSLQLKT----- 81 Query: 328 FLVLCPLSVTDGWLS 372 L++CPLS+ + W++ Sbjct: 82 -LIVCPLSLINHWVT 95
>RAD54_SCHPO (P41410) DNA repair protein rhp54 (EC 3.6.1.-) (RAD54 homolog 1)| Length = 852 Score = 45.4 bits (106), Expect = 3e-05 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 10/75 (13%) Frame = +1 Query: 172 LKPHQLDGVHWLIR----RYHLGVN-VLLGDEMGLGKTLQAISLL-SYLKIKSIAPRP-- 327 L+PHQ++GV +L + R N ++ DEMGLGKTLQ I+LL + LK A +P Sbjct: 264 LRPHQIEGVKFLYKCVTGRIDRCANGCIMADEMGLGKTLQCIALLWTLLKQSPQAGKPTI 323 Query: 328 --FLVLCPLSVTDGW 366 ++ CP S+ W Sbjct: 324 EKAIITCPSSLVKNW 338
>SMAL1_MOUSE (Q8BJL0) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A-like protein 1 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 1) (HepA-related protein) (mharp) Length = 910 Score = 44.7 bits (104), Expect = 6e-05 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 2/84 (2%) Frame = +1 Query: 121 KSQLPR--LSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLS 294 K+ +P LS D + + L P Q +GV + I + +LL D+MGLGKT+QAI + + Sbjct: 376 KADVPEADLSGVDAKLVSSLMPFQREGVSFAISKRG---RLLLADDMGLGKTVQAICIAA 432 Query: 295 YLKIKSIAPRPFLVLCPLSVTDGW 366 + + P LV+ P SV W Sbjct: 433 FYR----KEWPLLVVVPSSVRFTW 452
>SMAL1_BOVIN (Q9TTA5) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A-like protein 1 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 1) (DNA-dependent ATPase A) (HepA-related protein) Length = 941 Score = 43.9 bits (102), Expect = 1e-04 Identities = 29/76 (38%), Positives = 41/76 (53%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIA 318 LS D + + L P Q GV++ I + +LL D+MGLGKT+QAI + +Y + Sbjct: 423 LSRVDSKLVSSLLPFQRAGVNFAIAQRG---RLLLADDMGLGKTIQAICIAAYYR----K 475 Query: 319 PRPFLVLCPLSVTDGW 366 P LV+ P SV W Sbjct: 476 EWPLLVVVPSSVRFTW 491
>RAD54_MOUSE (P70270) DNA repair and recombination protein RAD54-like (EC| 3.6.1.-) (RAD54 homolog) (mRAD54) (mHR54) Length = 747 Score = 43.1 bits (100), Expect = 2e-04 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +1 Query: 121 KSQLPRLSSADLGVTADLKPHQLDGVHWL-----IRRYHLGVNVLLGDEMGLGKTLQAIS 285 K +LP D ++ L+PHQ +GV +L RR ++ DEMGLGKTLQ I+ Sbjct: 136 KEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCIT 195 Query: 286 LLSYLKIKSIAPRP----FLVLCPLSVTDGW 366 L+ L +S +P +V+ P S+ W Sbjct: 196 LMWTLLRQSPECKPEIEKAVVVSPSSLVKNW 226
>RAD54_HUMAN (Q92698) DNA repair and recombination protein RAD54-like (EC| 3.6.1.-) (RAD54 homolog) (hRAD54) (hHR54) Length = 747 Score = 43.1 bits (100), Expect = 2e-04 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +1 Query: 121 KSQLPRLSSADLGVTADLKPHQLDGVHWL-----IRRYHLGVNVLLGDEMGLGKTLQAIS 285 K +LP D ++ L+PHQ +GV +L RR ++ DEMGLGKTLQ I+ Sbjct: 136 KEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCIT 195 Query: 286 LLSYLKIKSIAPRP----FLVLCPLSVTDGW 366 L+ L +S +P +V+ P S+ W Sbjct: 196 LMWTLLRQSPECKPEIDKAVVVSPSSLVKNW 226
>RAPA_PHOPR (Q6LV34) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 972 Score = 43.1 bits (100), Expect = 2e-04 Identities = 28/71 (39%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL H + RRY VLL DE+GLGKT++A ++ + A R L+ Sbjct: 149 GMRAGLIPHQLFIAHEVGRRY--APRVLLADEVGLGKTIEAGMIIHQQVLAGRAER-ILI 205 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 206 VVPETLQHQWL 216
>YBMA_SCHPO (Q10332) Probable ATP-dependent helicase C582.10c in chromosome II| (EC 3.6.1.-) Length = 830 Score = 42.7 bits (99), Expect = 2e-04 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 6/87 (6%) Frame = +1 Query: 130 LPRLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNV----LLGDEMGLGKTLQAISL-LS 294 + R SS G+ L HQ+ G+ WL R + + +L D+MGLGKT+Q I+L LS Sbjct: 219 MQRQSSFIPGMHIRLLDHQVQGLTWLKSRETVSKSSASGGILADDMGLGKTIQMIALILS 278 Query: 295 Y-LKIKSIAPRPFLVLCPLSVTDGWLS 372 + L K + + LV+ PLS+ W S Sbjct: 279 HPLPKKKHSIKSTLVVAPLSLIKQWES 305
>RAPA_SALTY (Q8ZRV8) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 42.4 bits (98), Expect = 3e-04 Identities = 26/71 (36%), Positives = 42/71 (59%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G +L PHQL+ H + RR+ VLL DE+GLGKT++A ++ + ++ S A L+ Sbjct: 148 GQRTNLIPHQLNIAHDVGRRH--APRVLLADEVGLGKTIEA-GMILHQQLLSGAAERVLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>RAPA_SALTI (Q8Z9J4) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 42.4 bits (98), Expect = 3e-04 Identities = 26/71 (36%), Positives = 42/71 (59%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G +L PHQL+ H + RR+ VLL DE+GLGKT++A ++ + ++ S A L+ Sbjct: 148 GQRTNLIPHQLNIAHDVGRRH--APRVLLADEVGLGKTIEA-GMILHQQLLSGAAERVLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>RAPA_PHOLL (Q7N8V1) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 970 Score = 42.4 bits (98), Expect = 3e-04 Identities = 28/71 (39%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL + + +RY VLL DE+GLGKT++A ++ + A R LV Sbjct: 149 GIRASLIPHQLHIANEVGKRY--APRVLLADEVGLGKTIEAGMIIHQQLLAGRAER-VLV 205 Query: 337 LCPLSVTDGWL 369 + P S+ WL Sbjct: 206 IVPDSLQHQWL 216
>Y018_MYCGE (P47264) Hypothetical ATP-dependent helicase MG018 (EC 3.6.1.-)| Length = 1031 Score = 42.4 bits (98), Expect = 3e-04 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +1 Query: 145 SADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAI--SLLSYLKIKSIA 318 S D +L+ +Q +GV W+ +L DEMGLGKT Q I L SY KS+ Sbjct: 569 SLDNNQINNLRKYQKEGVKWIRALEDNQFGGILADEMGLGKTAQVIFAMLDSYQSTKSLL 628 Query: 319 PRPFLVLCPLSVTDGWLS 372 P L++ P S+ W S Sbjct: 629 PS--LIIVPASLLLNWKS 644
>Y020_MYCPN (P75093) Hypothetical ATP-dependent helicase MPN020 (EC 3.6.1.-)| (D12_orf1030) Length = 1030 Score = 42.4 bits (98), Expect = 3e-04 Identities = 24/67 (35%), Positives = 35/67 (52%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLS 351 L+ +Q +GV W+ +L DEMGLGKT+Q I L +K+ P L++ P S Sbjct: 578 LRNYQQEGVKWIRGLEENKFGGILADEMGLGKTVQVIFALLDSYLKNHVNLPSLIIVPAS 637 Query: 352 VTDGWLS 372 + W S Sbjct: 638 LLLNWKS 644
>RHP16_SCHPO (P79051) DNA repair protein rhp16 (RAD16 homolog)| Length = 861 Score = 42.0 bits (97), Expect = 4e-04 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGVNV-LLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCP 345 +L P Q +GV+WL R+ +L DEMG+GKT+Q I+LL + +P LV+ P Sbjct: 254 NLLPFQREGVYWLKRQEDSSFGGGILADEMGMGKTIQTIALL----LSEPRGKPTLVVAP 309 Query: 346 LSVTDGW 366 + W Sbjct: 310 VVAIMQW 316
>RAD54_CHICK (O12944) DNA repair and recombination protein RAD54-like (EC| 3.6.1.-) (RAD54 homolog) (Putative recombination factor GdRad54) (Fragment) Length = 733 Score = 42.0 bits (97), Expect = 4e-04 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +1 Query: 121 KSQLPRLSSADLGVTADLKPHQLDGVHWL-----IRRYHLGVNVLLGDEMGLGKTLQAIS 285 K ++P D ++ L+PHQ +GV +L RR ++ DEMGLGKTLQ I+ Sbjct: 125 KDKVPVHVVVDPVLSRVLRPHQREGVKFLWDCVTSRRIPGSHGCIMADEMGLGKTLQCIT 184 Query: 286 LLSYLKIKSIAPRP----FLVLCPLSVTDGW 366 L+ L +S +P +V+ P S+ W Sbjct: 185 LMWTLLRQSPDCKPEIEKAMVVSPSSLVRNW 215
>RAPA_SHIFL (Q7UDT5) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 42.0 bits (97), Expect = 4e-04 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G L PHQL+ H + RR+ VLL DE+GLGKT++A ++ + ++ S A L+ Sbjct: 148 GQRTSLIPHQLNIAHDVGRRH--APRVLLADEVGLGKTIEA-GMILHQQLLSGAAERVLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>RAPA_ECOLI (P60240) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 42.0 bits (97), Expect = 4e-04 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G L PHQL+ H + RR+ VLL DE+GLGKT++A ++ + ++ S A L+ Sbjct: 148 GQRTSLIPHQLNIAHDVGRRH--APRVLLADEVGLGKTIEA-GMILHQQLLSGAAERVLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>RAPA_ECOL6 (Q8FL92) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 42.0 bits (97), Expect = 4e-04 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G L PHQL+ H + RR+ VLL DE+GLGKT++A ++ + ++ S A L+ Sbjct: 148 GQRTSLIPHQLNIAHDVGRRH--APRVLLADEVGLGKTIEA-GMILHQQLLSGAAERVLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>RAPA_ECO57 (P60241) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 42.0 bits (97), Expect = 4e-04 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G L PHQL+ H + RR+ VLL DE+GLGKT++A ++ + ++ S A L+ Sbjct: 148 GQRTSLIPHQLNIAHDVGRRH--APRVLLADEVGLGKTIEA-GMILHQQLLSGAAERVLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>EP400_HUMAN (Q96L91) E1A-binding protein p400 (EC 3.6.1.-) (p400 kDa| SWI2/SNF2-related protein) (Domino homolog) (hDomino) (CAG repeat protein 32) (Trinucleotide repeat-containing gene 12 protein) Length = 3160 Score = 41.6 bits (96), Expect = 5e-04 Identities = 21/56 (37%), Positives = 32/56 (57%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 L+ +Q G+ WL + Y +N +L DE GLGKT+Q I+ ++L P LV+ Sbjct: 1091 LRDYQKIGLDWLAKLYRKNLNGILADEAGLGKTVQIIAFFAHLACNEGNWGPHLVV 1146
>RAPA_VIBPA (Q87LD0) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 969 Score = 41.6 bits (96), Expect = 5e-04 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL H + RR+ VLL DE+GLGKT++A ++ + ++ S L+ Sbjct: 149 GMRAGLIPHQLYIAHEVGRRH--APRVLLADEVGLGKTIEA-GMIIHQQVLSGRAERILI 205 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 206 VVPETLQHQWL 216
>EP400_MOUSE (Q8CHI8) E1A-binding protein p400 (EC 3.6.1.-) (p400 kDa| SWI2/SNF2-related protein) (Domino homolog) (mDomino) Length = 3072 Score = 41.6 bits (96), Expect = 5e-04 Identities = 21/56 (37%), Positives = 32/56 (57%) Frame = +1 Query: 172 LKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 L+ +Q G+ WL + Y +N +L DE GLGKT+Q I+ ++L P LV+ Sbjct: 1090 LRDYQKIGLDWLAKLYRKNLNGILADEAGLGKTVQIIAFFAHLACNEGNWGPHLVV 1145
>ATRX_MOUSE (Q61687) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked nuclear protein) (Heterochromatin protein 2) (HP1 alpha-interacting protein) (HP1-BP38 protein) Length = 2476 Score = 41.6 bits (96), Expect = 5e-04 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Frame = +1 Query: 172 LKPHQLDGVHWLI---------RRYHLGVNVLLGDEMGLGKTLQAISLL-SYLKIKSIAP 321 LKPHQ+DGV ++ + G +L MGLGKTLQ +S L + L + Sbjct: 1545 LKPHQVDGVQFMWDCCCESVEKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDF 1604 Query: 322 RPFLVLCPLSVTDGWLS 372 LV+CPL+ W++ Sbjct: 1605 STALVVCPLNTALNWMN 1621
>ATRX_PONPY (Q7YQM3) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked helicase II) (X-linked nuclear protein) (XNP) Length = 2492 Score = 41.6 bits (96), Expect = 5e-04 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Frame = +1 Query: 172 LKPHQLDGVHWLI---------RRYHLGVNVLLGDEMGLGKTLQAISLL-SYLKIKSIAP 321 LKPHQ+DGV ++ + G +L MGLGKTLQ +S L + L + Sbjct: 1560 LKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDF 1619 Query: 322 RPFLVLCPLSVTDGWLS 372 LV+CPL+ W++ Sbjct: 1620 STALVVCPLNTALNWMN 1636
>ATRX_PANTR (Q7YQM4) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked helicase II) (X-linked nuclear protein) (XNP) Length = 2492 Score = 41.6 bits (96), Expect = 5e-04 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Frame = +1 Query: 172 LKPHQLDGVHWLI---------RRYHLGVNVLLGDEMGLGKTLQAISLL-SYLKIKSIAP 321 LKPHQ+DGV ++ + G +L MGLGKTLQ +S L + L + Sbjct: 1560 LKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDF 1619 Query: 322 RPFLVLCPLSVTDGWLS 372 LV+CPL+ W++ Sbjct: 1620 STALVVCPLNTALNWMN 1636
>ATRX_HUMAN (P46100) Transcriptional regulator ATRX (EC 3.6.1.-) (ATP-dependent| helicase ATRX) (X-linked helicase II) (X-linked nuclear protein) (XNP) (Znf-HX) Length = 2492 Score = 41.6 bits (96), Expect = 5e-04 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Frame = +1 Query: 172 LKPHQLDGVHWLI---------RRYHLGVNVLLGDEMGLGKTLQAISLL-SYLKIKSIAP 321 LKPHQ+DGV ++ + G +L MGLGKTLQ +S L + L + Sbjct: 1560 LKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDF 1619 Query: 322 RPFLVLCPLSVTDGWLS 372 LV+CPL+ W++ Sbjct: 1620 STALVVCPLNTALNWMN 1636
>RAPA_VIBCH (Q9KP70) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 969 Score = 41.2 bits (95), Expect = 6e-04 Identities = 27/71 (38%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL H + RR+ VLL DE+GLGKT++A ++ + A R L+ Sbjct: 149 GMRAGLIPHQLYIAHEVGRRH--APRVLLADEVGLGKTIEAGMIIHQQVLTGRAER-ILI 205 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 206 VVPETLQHQWL 216
>RAPA_VIBVY (Q7MHE6) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 969 Score = 40.8 bits (94), Expect = 8e-04 Identities = 27/71 (38%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL H + RR+ VLL DE+GLGKT++A ++ + A R L+ Sbjct: 149 GMRAGLIPHQLYIAHEVGRRH--APRVLLADEVGLGKTIEAGMIIHQQVLLGRAER-ILI 205 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 206 VVPETLQHQWL 216
>RAPA_VIBVU (Q8DCG1) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 969 Score = 40.8 bits (94), Expect = 8e-04 Identities = 27/71 (38%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL H + RR+ VLL DE+GLGKT++A ++ + A R L+ Sbjct: 149 GMRAGLIPHQLYIAHEVGRRH--APRVLLADEVGLGKTIEAGMIIHQQVLLGRAER-ILI 205 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 206 VVPETLQHQWL 216
>RA54B_HUMAN (Q9Y620) DNA repair and recombination protein RAD54B (EC 3.6.1.-)| (RAD54 homolog B) Length = 910 Score = 40.8 bits (94), Expect = 8e-04 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 10/75 (13%) Frame = +1 Query: 172 LKPHQLDGVHWLIR-----RYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKS-IAPRPF- 330 L+PHQ +G+ +L R + +L DEMGLGKTLQ ISL+ L+ + +P Sbjct: 296 LRPHQKEGIIFLYECVMGMRMNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVI 355 Query: 331 ---LVLCPLSVTDGW 366 L++ P S+ + W Sbjct: 356 KKTLIVTPGSLVNNW 370
>GTA_NPVOP (O10302) Probable global transactivator (EC 3.6.1.-) (ATP-dependent| helicase GTA) Length = 498 Score = 40.8 bits (94), Expect = 8e-04 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Frame = +1 Query: 169 DLKPHQLDGVHWLIRRYHLGV--NVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLC 342 +L HQ G+ W+ RR G +L D+MGLGKTL + L++ L++C Sbjct: 28 NLLEHQKRGIEWMRRRERRGRPHGGVLADDMGLGKTLSVMRLIAN---DGDDAHKTLIVC 84 Query: 343 PLSVTDGW 366 PLS+ + W Sbjct: 85 PLSLLNHW 92
>RAPA_SHEON (Q8EJ93) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 968 Score = 40.8 bits (94), Expect = 8e-04 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 4/82 (4%) Frame = +1 Query: 136 RLSSADL----GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLK 303 +L+++DL G L PHQ+ H + RRY VLL DE+GLGKT++A L+ + + Sbjct: 137 QLATSDLLGLQGPRVGLIPHQMWIAHEVGRRY--APRVLLADEVGLGKTIEA-GLIIHQQ 193 Query: 304 IKSIAPRPFLVLCPLSVTDGWL 369 + + L++ P ++ WL Sbjct: 194 LLTCRAERVLIIVPDTLRHQWL 215
>RA54B_MOUSE (Q6PFE3) DNA repair and recombination protein RAD54B (EC 3.6.1.-)| (RAD54 homolog B) Length = 886 Score = 40.4 bits (93), Expect = 0.001 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 10/75 (13%) Frame = +1 Query: 172 LKPHQLDGVHWLIR-----RYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKS-IAPRPF- 330 L+PHQ DG+ +L R +L DEMGLGKTLQ ISL+ L+ + +P Sbjct: 274 LRPHQKDGIIFLYECVMGMRAVGKCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVI 333 Query: 331 ---LVLCPLSVTDGW 366 L++ P S+ + W Sbjct: 334 KKTLIVTPGSLVNNW 348
>RAPA_YERPS (Q66EN4) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 968 Score = 40.0 bits (92), Expect = 0.001 Identities = 26/71 (36%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL + + +R+ VLL DE+GLGKT++A ++ + A R L+ Sbjct: 149 GIRASLIPHQLHIAYEVGQRH--APRVLLADEVGLGKTIEAGMIIHQQLLAGRAER-VLI 205 Query: 337 LCPLSVTDGWL 369 + P S+ WL Sbjct: 206 VVPESLQHQWL 216
>RAPA_YERPE (Q8ZII0) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 968 Score = 40.0 bits (92), Expect = 0.001 Identities = 26/71 (36%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL + + +R+ VLL DE+GLGKT++A ++ + A R L+ Sbjct: 149 GIRASLIPHQLHIAYEVGQRH--APRVLLADEVGLGKTIEAGMIIHQQLLAGRAER-VLI 205 Query: 337 LCPLSVTDGWL 369 + P S+ WL Sbjct: 206 VVPESLQHQWL 216
>YQHH_BACSU (P54509) Hypothetical ATP-dependent helicase yqhH (EC 3.6.1.-)| Length = 557 Score = 39.7 bits (91), Expect = 0.002 Identities = 21/64 (32%), Positives = 37/64 (57%) Frame = +1 Query: 178 PHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLSVT 357 PHQL+ ++ + + +L DE+GLGKT++A +L I+ +A + L+L P S+ Sbjct: 62 PHQLEVAQKVVEK--MNGKAILADEVGLGKTVEAGLILKEYMIRGLA-KKILILVPASLV 118 Query: 358 DGWL 369 W+ Sbjct: 119 SQWV 122
>RAPA_HAEDU (Q7VKV0) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 973 Score = 39.3 bits (90), Expect = 0.002 Identities = 28/71 (39%), Positives = 37/71 (52%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL + +R + VLL DE+GLGKT++A +L R LV Sbjct: 147 GIRASLIPHQLHIAKEVGQR--VAPRVLLADEVGLGKTIEAGMILQQQLFSGRVER-VLV 203 Query: 337 LCPLSVTDGWL 369 L P S+ WL Sbjct: 204 LVPESLQHQWL 214
>RA54B_CHICK (Q9DG67) DNA repair and recombination protein RAD54B (EC 3.6.1.-)| (RAD54 homolog B) Length = 918 Score = 39.3 bits (90), Expect = 0.002 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 11/80 (13%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNV------LLGDEMGLGKTLQAISLLSYLKIKSI-- 315 + +L+PHQ +G+ +L +G+ V +L DEMGLGKTLQ ISL+ L + + Sbjct: 299 IANNLRPHQREGIVFLYECV-MGMRVSGRFGAILADEMGLGKTLQCISLVWTLLRQGVYG 357 Query: 316 ---APRPFLVLCPLSVTDGW 366 + L++ P S+ W Sbjct: 358 CKPVLKRALIVTPGSLVKNW 377
>ATRX_DROME (Q9GQN5) Transcriptional regulator ATRX homolog (EC 3.6.1.-)| (ATP-dependent helicase XNP) (X-linked nuclear protein) (dXNP) (d-xnp) Length = 1311 Score = 38.5 bits (88), Expect = 0.004 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 11/87 (12%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVHWLI---------RRYHLGVNVLLGDEMGLGKTLQAISLL 291 L D G+ LKPHQ+ GV ++ + G +L MGLGKTLQ ++L Sbjct: 444 LLQVDKGLLKKLKPHQVAGVKFMWDACFETLKESQEKPGSGCILAHCMGLGKTLQVVTLS 503 Query: 292 SYLKI--KSIAPRPFLVLCPLSVTDGW 366 L + + L++ PLS + W Sbjct: 504 HTLLVNTRRTGVDRVLIISPLSTVNNW 530
>RAPA_ERWCT (Q6D0E6) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 38.1 bits (87), Expect = 0.005 Identities = 25/71 (35%), Positives = 40/71 (56%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL + + +R+ VLL DE+GLGKT++A ++ + A R L+ Sbjct: 148 GMRASLIPHQLHIAYEVGQRH--APRVLLADEVGLGKTIEAGMIIHQQLLAGRASR-VLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 VVPETLQHQWL 215
>RDH54_SCHPO (Q09772) Meiotic recombination protein rdh54 (EC 3.6.1.-)| (ATP-dependent helicase rdh54) (RAD54 protein homolog 2) Length = 811 Score = 38.1 bits (87), Expect = 0.005 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%) Frame = +1 Query: 172 LKPHQLDGVHWLI-----RRYHLGVNVLLGDEMGLGKTLQAISLL------SYLKIKSIA 318 L HQ +GV +L G + +L DEMGLGKTLQ I+++ SY +S Sbjct: 205 LYSHQREGVSFLYDCLLGMEGKCGYSAILADEMGLGKTLQTITVVWTLLKQSYYANRSST 264 Query: 319 PRPFLVLCPLSVTDGW 366 +V+ P+++ W Sbjct: 265 INNAMVVAPVTLLKNW 280
>RAPA_PASMU (Q9CK01) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 967 Score = 35.8 bits (81), Expect = 0.026 Identities = 25/71 (35%), Positives = 36/71 (50%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G+ A L PHQL + +R VLL DE+GLGKT++A +L R L+ Sbjct: 148 GIRAGLIPHQLHIAREVGQR--TAPRVLLADEVGLGKTIEAGMILQQQLFAEKVER-VLI 204 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 205 IVPETLQHQWL 215
>RAD5_SCHPO (P36607) DNA repair protein rad5 (EC 3.6.1.-)| Length = 1133 Score = 35.4 bits (80), Expect = 0.034 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 16/68 (23%) Frame = +1 Query: 217 YHLGVNVLLGDEMGLGKTLQAISLLSYLKIKS----------------IAPRPFLVLCPL 348 YH G +L DEMGLGKT++ +SL+ S +A R LV+ P+ Sbjct: 521 YHRGG--ILADEMGLGKTIEVLSLIHSRPCFSTDEIPEAFRHSKPSLPVASRTTLVVAPM 578 Query: 349 SVTDGWLS 372 S+ D W S Sbjct: 579 SLLDQWHS 586
>RAD5_EMENI (Q5BHD6) DNA repair protein rad5 (EC 3.6.1.-)| Length = 1202 Score = 35.0 bits (79), Expect = 0.044 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 17/60 (28%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISL---------------LSYLKIKSIAPRPF--LVLCPLSVTDGW 366 +L DEMGLGKT++ +SL L+ L + + P P+ LV+ P+S+ W Sbjct: 514 ILADEMGLGKTIEMLSLVHSHRNLPPTQSLGNLTRLPVSGVVPAPYTTLVVAPMSLLAQW 573
>RAPA_PSESM (Q87XS2) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 948 Score = 34.3 bits (77), Expect = 0.076 Identities = 25/71 (35%), Positives = 37/71 (52%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 GV A HQL + R + VLL DE+GLGKT++A L+ + ++ S L+ Sbjct: 149 GVRAQPIAHQLHIAREVADR--IAPRVLLADEVGLGKTIEA-GLVIHRQLLSGRANRVLI 205 Query: 337 LCPLSVTDGWL 369 L P ++ WL Sbjct: 206 LVPENLQHQWL 216
>RAD54_YEAST (P32863) DNA repair and recombination protein RAD54 (EC 3.6.1.-)| Length = 898 Score = 34.3 bits (77), Expect = 0.076 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLLSYLKIKSIAPRPF----LVLCPLSVTDGW 366 ++ DEMGLGKTLQ I+L+ L + + +++CP S+ + W Sbjct: 332 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNW 378
>RAPA_HAEIN (P44781) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 923 Score = 34.3 bits (77), Expect = 0.076 Identities = 25/71 (35%), Positives = 35/71 (49%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 G A L PHQL + R + VLL DE+GLGKT++A +L R L+ Sbjct: 147 GTRASLIPHQLHIAAEVGNR--VNPRVLLADEVGLGKTIEAGMILQNQLFAEKVQR-VLI 203 Query: 337 LCPLSVTDGWL 369 + P ++ WL Sbjct: 204 IVPETLQHQWL 214
>RAPA_PSEAE (Q9HYT6) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 950 Score = 32.7 bits (73), Expect = 0.22 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 1/84 (1%) Frame = +1 Query: 121 KSQLPRLSSADLG-VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSY 297 +SQL + S LG A HQL + R + VLL DE+GLGKT++A L+ + Sbjct: 137 RSQLLQSSLWGLGGARAQPIAHQLHIAREVADR--MAPRVLLADEVGLGKTIEA-GLIIH 193 Query: 298 LKIKSIAPRPFLVLCPLSVTDGWL 369 ++ S L+L P ++ WL Sbjct: 194 RQLLSGRAGRVLILVPENLQHQWL 217
>RAPA_PSEPK (Q88NR0) RNA polymerase-associated protein rapA (EC 3.6.1.-)| (ATP-dependent helicase hepA) Length = 948 Score = 32.0 bits (71), Expect = 0.38 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +1 Query: 235 VLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLSVTDGWL 369 VLL DE+GLGKT++A L+ + ++ S L+L P ++ WL Sbjct: 173 VLLADEVGLGKTIEA-GLVIHRQLLSGRASRVLILVPENLQHQWL 216
>SUUR_DROME (Q9VTE2) Protein suppressor of underreplication| Length = 962 Score = 32.0 bits (71), Expect = 0.38 Identities = 20/47 (42%), Positives = 24/47 (51%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYL 300 VT LK QLD V ++ R +L DE GLGK +LLS L Sbjct: 24 VTQYLKSFQLDAVRFVYDRLAKREFCILNDESGLGKVATVAALLSAL 70
>SUUR_DROER (P59597) Protein suppressor of underreplication| Length = 962 Score = 32.0 bits (71), Expect = 0.38 Identities = 20/47 (42%), Positives = 24/47 (51%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYL 300 VT LK QLD V ++ R +L DE GLGK +LLS L Sbjct: 24 VTQYLKSFQLDAVRFVYDRLAKREFCILNDESGLGKVATVAALLSAL 70
>TTF2_HUMAN (Q9UNY4) Transcription termination factor 2 (EC 3.6.1.-) (RNA| polymerase II termination factor) (Transcription release factor 2) (Factor 2) (F2) (HuF2) (Lodestar homolog) Length = 1162 Score = 32.0 bits (71), Expect = 0.38 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLI-RRYHLGVNVLLGDEMGLGKTLQAISLL 291 G+ L HQ + WL+ R +L D+MGLGKTL I+L+ Sbjct: 565 GLKVPLLLHQKQALAWLLWRESQKPQGGILADDMGLGKTLTMIALI 610
>TTF2_MOUSE (Q5NC05) Transcription termination factor 2 (EC 3.6.1.-) (RNA| polymerase II termination factor) (Transcription release factor 2) Length = 1184 Score = 32.0 bits (71), Expect = 0.38 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 157 GVTADLKPHQLDGVHWLI-RRYHLGVNVLLGDEMGLGKTLQAISLL 291 G+ L HQ + WL+ R +L D+MGLGKTL I+L+ Sbjct: 542 GLKVPLLLHQKQALAWLLWRESQKPQGGILADDMGLGKTLTMIALI 587
>IHH_XENLA (Q91612) Indian hedgehog protein precursor (IHH) (Banded hedgehog| protein) (X-BHH) [Contains: Indian hedgehog protein N-product; Indian hedgehog protein C-product] Length = 409 Score = 32.0 bits (71), Expect = 0.38 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 151 DLGVTADLKPHQLDGVHWLIRR-YHLGVNVLLGDE 252 +LG+ A +P Q G+HW + YHLG +L G+E Sbjct: 364 NLGIIAGTQPSQQMGIHWYSKALYHLGRLILHGNE 398
>TTF2_DROME (P34739) Transcription termination factor 2 (EC 3.6.1.-) (RNA| polymerase II termination factor) (Transcription release factor 2) (Protein lodestar) Length = 1061 Score = 32.0 bits (71), Expect = 0.38 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 139 LSSADLGVTADLKPHQLDGVHWLI-RRYHLGVNVLLGDEMGLGKTLQAIS 285 L+ +G+ L HQ + W+ R L +L D+MGLGKTL IS Sbjct: 428 LAEDPVGLKVSLMNHQKHALAWMSWRERKLPRGGILADDMGLGKTLTMIS 477
>RAD5_DEBHA (Q6BIP2) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1153 Score = 31.2 bits (69), Expect = 0.64 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 13/56 (23%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLLSYLKI------------KSI-APRPFLVLCPLSVTDGW 366 +L DEMGLGKT+ ++L++ + I K+I A + L++ P+S+ W Sbjct: 541 ILADEMGLGKTISTLALINSVPIDVMFEENKELEDKTIYASKTTLIIVPMSLLSQW 596
>ATRX_CAEEL (Q9U7E0) Transcriptional regulator ATRX homolog (EC 3.6.1.-)| (ATP-dependent helicase xnp-1) (X-linked nuclear protein 1) Length = 1359 Score = 31.2 bits (69), Expect = 0.64 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 12/77 (15%) Frame = +1 Query: 172 LKPHQLDGVHWLI--------RRYHLGVNVLLGDEMGLGKTLQAI----SLLSYLKIKSI 315 LKPHQ G+ ++ R G +L MGLGKTLQ I ++L + KI Sbjct: 463 LKPHQAHGIQFMYDCACESLDRLDTEGSGGILAHCMGLGKTLQVITFLHTVLMHEKIGEK 522 Query: 316 APRPFLVLCPLSVTDGW 366 R LV+ P +V W Sbjct: 523 CKR-VLVVVPKNVIINW 538
>RDH54_YEAST (P38086) DNA repair and recombination protein RDH54 (RAD homolog| 54) (Recombination factor TID1) (Two-hybrid interaction with DMC1 protein 1) [Includes: DNA topoisomerase (EC 5.99.1.-); Putative helicase (EC 3.6.1.-)] Length = 924 Score = 30.4 bits (67), Expect = 1.1 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 20/63 (31%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLLSYLKIKSIAPRPF--------------------LVLCPLSVT 357 LL D+MGLGKTL +I+L+ L I PF LV+CP+++ Sbjct: 309 LLADDMGLGKTLMSITLIWTL----IRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLI 364 Query: 358 DGW 366 W Sbjct: 365 GNW 367
>RAD5_CANAL (Q5ACX1) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1084 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 9/54 (16%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLLSYLKIKSI----APRPF-----LVLCPLSVTDGWLS 372 +L DEMGLGKT+ ++L++ + + + RP+ L++ P+S+ W S Sbjct: 460 ILADEMGLGKTIATLALVNSVPYDNFPEPKSDRPYASQTTLIVVPMSLLFQWKS 513
>RAD5_NEUCR (Q7S1P9) DNA repair protein rad-5 (EC 3.6.1.-)| Length = 1222 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT+Q +SL+ Sbjct: 578 ILADEMGLGKTIQMLSLI 595
>RAD5_CANGA (Q6FY76) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1151 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT+ A+SL+ Sbjct: 510 ILSDEMGLGKTISALSLV 527
>VP41_BPAPS (Q9T1Q7) Putative protein p41| Length = 460 Score = 29.6 bits (65), Expect = 1.9 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%) Frame = +1 Query: 220 HLGVNVLLGDE-------MGLGKTLQAISLLSYLKIKSIAPRPFLVLCPLSV 354 HL +N LL + MG+GKT ++ L L + +P LVL PL V Sbjct: 11 HLIINHLLDIKRSNVWAGMGMGKTAATLTALENLYLSGSETKPTLVLAPLRV 62
>RAD5_GIBZE (Q4IJ84) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1154 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT+Q +SL+ Sbjct: 516 ILADEMGLGKTIQMLSLV 533
>SYE_LISIN (Q92F38) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 491 Score = 29.3 bits (64), Expect = 2.4 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +1 Query: 130 LPRLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIK 309 LP L A + V+ADL +LD VH L+ YH ++M G + +S + + + Sbjct: 344 LPHLQKAGV-VSADLDQAELDWVHKLVSLYH--------EQMSYGAEIVPLSEMFFADAE 394 Query: 310 SI 315 SI Sbjct: 395 SI 396
>RAD5_ASPFU (Q4WVM1) DNA repair protein rad5 (EC 3.6.1.-)| Length = 1245 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT++ +SL+ Sbjct: 561 ILADEMGLGKTIEMLSLI 578
>RAD5_KLULA (Q6CJM4) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1114 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT+ A++L+ Sbjct: 481 ILADEMGLGKTISALALI 498
>SM3L1_ARATH (Q9FF61) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 1 (EC 3.6.1.-) (SMARCA3-like protein 1) Length = 881 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 29/75 (38%) Frame = +1 Query: 160 VTADLKPHQLDGVHWLIRRYHLG-------------VNVL----------------LGDE 252 + ++L HQ +G+ WL+ R G +N L D+ Sbjct: 227 IKSELFAHQKEGLGWLLHREKSGELPPFWEEKDGEFLNTLTNYRSDKRPDPLRGGVFADD 286 Query: 253 MGLGKTLQAISLLSY 297 MGLGKTL +SL+++ Sbjct: 287 MGLGKTLTLLSLIAF 301
>COBB_THEVO (Q97BP4) Probable cobyrinic acid A,C-diamide synthase| Length = 454 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 235 VLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLV 336 ++ G G+GKT ++++S LK K + +P+ V Sbjct: 7 IIAGTNSGVGKTTTTLAVISALKNKGLKVKPYKV 40
>RAD5_USTMA (Q4PGG5) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1387 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT+ SLL Sbjct: 655 ILADEMGLGKTIMVASLL 672
>SYE_LISMO (Q8YAB3) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 491 Score = 28.1 bits (61), Expect = 5.4 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +1 Query: 130 LPRLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIK 309 LP L A + V+A+L +LD VH L+ YH ++M G + +S + + + Sbjct: 344 LPHLQKAGV-VSAELNQAELDWVHKLVSLYH--------EQMSYGAEIVPLSEMFFADAE 394 Query: 310 SI 315 SI Sbjct: 395 SI 396
>SRPI_SYNP7 (Q55032) Protein srpI| Length = 306 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 239 RTLTPRW*RRMSQWTP 192 RT+TPRW R+ WTP Sbjct: 29 RTITPRWLVRLLHWTP 44
>RAD5_YEAST (P32849) DNA repair protein RAD5 (EC 3.6.1.-) (Radiation| sensitivity protein 5) (Revertibility protein 2) Length = 1169 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L DEMGLGKT+ A SL+ Sbjct: 529 ILSDEMGLGKTVAAYSLV 546
>MURC_VIBPA (Q87SG3) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 485 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 252 DGAGEDPAGNFSAELPEDQIHRPQAVPGVMPSERDGW 362 D GE GN A L +D H P V + + R GW Sbjct: 332 DHLGEFDTGNGHAMLVDDYGHHPTEVDVTIKAARSGW 368
>MURC_VIBCH (Q9KPG8) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 486 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 252 DGAGEDPAGNFSAELPEDQIHRPQAVPGVMPSERDGW 362 D GE GN A L +D H P V + + R+GW Sbjct: 332 DHLGEFETGNGVAMLVDDYGHHPTEVDVTIKAARNGW 368
>MURC_PHOPR (Q6LMF7) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 487 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 252 DGAGEDPAGNFSAELPEDQIHRPQAVPGVMPSERDGW 362 D GE GN S L +D H P V + + R GW Sbjct: 333 DHLGEFETGNGSVMLVDDYGHHPSEVDVTIQAARAGW 369
>SMRA3_RABIT (Q95216) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (RUSH-1) Length = 1005 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L D+MGLGKTL AI+++ Sbjct: 291 ILADDMGLGKTLTAIAVI 308
>SYE_LISMF (Q724H5) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 491 Score = 27.7 bits (60), Expect = 7.1 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +1 Query: 130 LPRLSSADLGVTADLKPHQLDGVHWLIRRYHLGVNVLLGDEMGLGKTLQAISLLSYLKIK 309 LP L A + V+A+L +LD VH L+ YH ++M G + +S + + + Sbjct: 344 LPHLQKAGV-VSAELDQAELDWVHKLVSLYH--------EQMSYGAEIVPLSEMFFADAE 394 Query: 310 SI 315 SI Sbjct: 395 SI 396
>SMRA3_MOUSE (Q6PCN7) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (TNF-response element-binding protein) (P113) Length = 1003 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L D+MGLGKTL AI+++ Sbjct: 291 ILADDMGLGKTLTAIAVI 308
>SMRA3_HUMAN (Q14527) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (DNA binding protein/plasminogen activator inhibitor 1 regulator) (Helicase-like tran Length = 1009 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L D+MGLGKTL AI+++ Sbjct: 291 ILADDMGLGKTLTAIAVI 308
>VASN_HUMAN (Q6EMK4) Vasorin precursor (Protein Slit-like 2)| Length = 673 Score = 27.3 bits (59), Expect = 9.3 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = +1 Query: 118 GKSQLPRLSSADLGVTADLKPHQLDGVHWL--IRRYHLGVNVLLGDEMGLGKTLQAISLL 291 G L RL A A L+P L G+ L + +L + L GD GL Sbjct: 237 GLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGL---------F 287 Query: 292 SYLKIKSIAPRPFLVLCPLSVTDGWL 369 L++ + A PF +CPLS W+ Sbjct: 288 PRLRLLAAARNPFNCVCPLSWFGPWV 313
>SM3L2_ARATH (Q9FNI6) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 2 (EC 3.6.1.-) (SMARCA3-like protein 2) Length = 1029 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLL 291 +L D MGLGKT+ ISLL Sbjct: 416 ILADAMGLGKTVMTISLL 433
>RAD5_ASHGO (Q753V5) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1085 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +1 Query: 238 LLGDEMGLGKTLQAISLLS 294 +L DEMGLGKT+ ++L++ Sbjct: 457 ILADEMGLGKTISILALIT 475
>NTP1_AMEPV (P29814) Nucleoside triphosphatase I (EC 3.6.1.15) (Nucleoside| triphosphate phosphohydrolase I) (NPH I) Length = 648 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 4/55 (7%) Frame = +1 Query: 187 LDGVHWLIRRYHLGV----NVLLGDEMGLGKTLQAISLLSYLKIKSIAPRPFLVL 339 L + + R +G+ ++LL + G+GKTL A+ ++ Y IK + PR +++ Sbjct: 37 LQDYQYFVSRIFIGLKNLNSMLLFWDTGMGKTLTAVYIIKY--IKELFPRWIILI 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,997,175 Number of Sequences: 219361 Number of extensions: 553874 Number of successful extensions: 1924 Number of sequences better than 10.0: 156 Number of HSP's better than 10.0 without gapping: 1849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1890 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)