| Clone Name | bastl27a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DPOA_SCHPO (P28040) DNA polymerase alpha catalytic subunit (EC 2... | 30 | 1.7 | 2 | GAG_FSVGR (P03339) Core protein p15 | 29 | 3.8 | 3 | PODXL_RABIT (Q28645) Podocalyxin-like protein 1 precursor | 28 | 4.9 | 4 | GAG_FSVGA (P03337) Gag polyprotein [Contains: Core protein p15; ... | 28 | 6.4 | 5 | THIL_CHRVI (P45369) Acetyl-CoA acetyltransferase (EC 2.3.1.9) (A... | 28 | 8.4 | 6 | VP61_NPVAC (Q03209) 61 kDa protein | 28 | 8.4 |
|---|
>DPOA_SCHPO (P28040) DNA polymerase alpha catalytic subunit (EC 2.7.7.7) (DNA| polymerase I) Length = 1405 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 16 ADPSQTVPSRLPPVPRALDSLPLPGGP 96 +DP + +P +P P+ SLP+P P Sbjct: 189 SDPKKYIPETVPSTPQPASSLPIPSSP 215
>GAG_FSVGR (P03339) Core protein p15| Length = 117 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 7 SLCADPSQTVPSRLPPVPRALDSLPLPGGPQP 102 SL DP V LPP P+ SLP P PQP Sbjct: 87 SLATDPPSWVRPFLPP-PKPPTSLPQPHSPQP 117
>PODXL_RABIT (Q28645) Podocalyxin-like protein 1 precursor| Length = 551 Score = 28.5 bits (62), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 25 SQTVPSRLPPVPRALDSLPLPGGPQP 102 +Q +PS +PP P + S P P P P Sbjct: 241 TQGMPSPMPPSPASPSSSPFPSSPSP 266
>GAG_FSVGA (P03337) Gag polyprotein [Contains: Core protein p15; Core protein| p12; Core protein p30] Length = 425 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 7 SLCADPSQTVPSRLPPVPRALDSLPLPGGPQP 102 SL DP V LPP P+ SLP P PQP Sbjct: 165 SLATDPPSWVRPFLPP-PKPPTSLPQPLSPQP 195
>THIL_CHRVI (P45369) Acetyl-CoA acetyltransferase (EC 2.3.1.9) (Acetoacetyl-CoA| thiolase) Length = 394 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 142 ASTSGFLRGRLSTMAAAPREEGESRELAGREEDGTGPFDLDQ 17 A GF R + AAA +++ E+ + AGR +D P ++ Q Sbjct: 166 AQKYGFTREQQDAFAAASQQKTEAAQKAGRFQDEIIPIEIPQ 207
>VP61_NPVAC (Q03209) 61 kDa protein| Length = 543 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 22 PSQTVPSRLPPVPRALDSLPLPGGPQP 102 P Q +P+ PP P + ++P P P P Sbjct: 176 PEQIIPAAPPPPPSPVPNIPAPPPPPP 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,091,148 Number of Sequences: 219361 Number of extensions: 190967 Number of successful extensions: 1246 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)