| Clone Name | bastl25f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AVP_HORVU (Q06572) Pyrophosphate-energized vacuolar membrane pro... | 88 | 7e-18 | 2 | AVP_PHAAU (P21616) Pyrophosphate-energized vacuolar membrane pro... | 56 | 3e-08 | 3 | AVP1_ARATH (P31414) Pyrophosphate-energized vacuolar membrane pr... | 55 | 4e-08 | 4 | ACOD_PIG (O02858) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl-C... | 29 | 3.7 |
|---|
>AVP_HORVU (Q06572) Pyrophosphate-energized vacuolar membrane proton pump (EC| 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase) (H(+)-PPase) Length = 762 Score = 87.8 bits (216), Expect = 7e-18 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 103 MAILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAA 234 MAILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAA Sbjct: 1 MAILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAA 44
>AVP_PHAAU (P21616) Pyrophosphate-energized vacuolar membrane proton pump (EC| 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase) (H(+)-PPase) (Vacuolar H(+)-pyrophosphatase) Length = 764 Score = 55.8 bits (133), Expect = 3e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 106 AILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVT 213 AIL +LGTEILIPVC VIGI FA+ QW +VSKVK++ Sbjct: 3 AILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLS 38
>AVP1_ARATH (P31414) Pyrophosphate-energized vacuolar membrane proton pump 1| (EC 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase 1) (H(+)-PPase 1) (Vacuolar proton pyrophosphatase 1) (Vacuolar proton pyrophosphatase 3) Length = 770 Score = 55.5 bits (132), Expect = 4e-08 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +1 Query: 94 LTAMAILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTP--GAASA 231 + A A+L EL TEIL+P+C VIGI F++ QW++VS+VK+T GA+S+ Sbjct: 1 MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSS 48
>ACOD_PIG (O02858) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl-CoA| desaturase) (Fatty acid desaturase) (Delta(9)-desaturase) (Fragment) Length = 334 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +1 Query: 94 LTAMAILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGA 222 L ++ LG L ILIP C + +++A A ++++S V VT GA Sbjct: 67 LMSLLHLGALYGIILIPTCKIYTLLWAFA-YYLLSAVGVTAGA 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,429,936 Number of Sequences: 219361 Number of extensions: 200731 Number of successful extensions: 611 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)