| Clone Name | bastl25f01 |
|---|---|
| Clone Library Name | barley_pub |
>ICI2_HORVU (P01053) Subtilisin-chymotrypsin inhibitor-2A (CI-2A)| Length = 83 Score = 44.7 bits (104), Expect = 7e-05 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 T WPE+VGKS+EEAK++IL+D PEA Sbjct: 22 TEWPELVGKSVEEAKKVILQDKPEA 46
>ICIA_HORVU (P16062) Subtilisin-chymotrypsin inhibitor CI-1A| Length = 83 Score = 42.4 bits (98), Expect = 4e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 TSWPEVVG S E+AKEIIL+D P A Sbjct: 26 TSWPEVVGMSAEKAKEIILRDKPNA 50
>ICIC_HORVU (P01054) Subtilisin-chymotrypsin inhibitor CI-1C| Length = 77 Score = 42.4 bits (98), Expect = 4e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 TSWPEVVG S E+AKEIIL+D P A Sbjct: 16 TSWPEVVGMSAEKAKEIILRDKPNA 40
>ICIW_WHEAT (P82977) Subtilisin-chymotrypsin inhibitor WSCI| Length = 72 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 T WPE+VGKS+EEAK++IL+D EA Sbjct: 11 TEWPELVGKSVEEAKKVILQDKSEA 35
>ICI3_HORVU (P08626) Subtilisin-chymotrypsin inhibitor-2B (CI-2B) (Fragment)| Length = 72 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 T WPE+V KS+EEAK++IL+D PEA Sbjct: 11 TEWPELVEKSVEEAKKVILQDKPEA 35
>ICIB_HORVU (P16063) Subtilisin-chymotrypsin inhibitor CI-1B| Length = 83 Score = 41.2 bits (95), Expect = 8e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 90 SWPEVVGKSIEEAKEIILKDMPEA 161 SWPEVVG S E+AKEIIL+D P+A Sbjct: 27 SWPEVVGMSAEKAKEIILRDKPDA 50
>ICI_LUMTE (P83472) Chymotrypsin inhibitor precursor (LTCI)| Length = 86 Score = 38.9 bits (89), Expect = 0.004 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 TSWPE+VG+++EEAK IL+D P+A Sbjct: 25 TSWPELVGETLEEAKAQILEDRPDA 49
>ICIS_VICFA (P08820) Subtilisin inhibitor (Fragment)| Length = 62 Score = 33.5 bits (75), Expect = 0.16 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEIILKDMPEA 161 TSWPE+VG S EEA++ I ++MPEA Sbjct: 2 TSWPELVGVSAEEARK-IKEEMPEA 25
>ICI_EISHO (P83830) Chymotrypsin inhibitor (EHCI) (Fragment)| Length = 41 Score = 32.3 bits (72), Expect = 0.36 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 90 SWPEVVGKSIEEAKEIILKDMPEA 161 +WPE+VGK+ EEA+ IL D P A Sbjct: 9 AWPELVGKTPEEARAQILLDKPNA 32
>LEGA_PEA (P02857) Legumin A precursor [Contains: Legumin A alpha chain| (Legumin A acidic chain); Legumin A beta chain (Legumin A basic chain)] Length = 517 Score = 30.4 bits (67), Expect = 1.4 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +2 Query: 38 EDELRRPKSPRRRGEED----VMAGGSGKVHRGGQGDH 139 EDE R+P+ RRRGEE+ GGS K QGD+ Sbjct: 295 EDEERQPRHQRRRGEEEEEDKKERGGSQKGKSRRQGDN 332
>IF2_MANSM (Q65SK9) Translation initiation factor IF-2| Length = 820 Score = 29.6 bits (65), Expect = 2.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 8 HISQVHACRIEDELRRPKSPRRRGEEDVMAGGSGKVHRGGQGDH 139 H++ +A EDE R K R RG+ V GK +GG+ D+ Sbjct: 158 HLTSTYAREAEDEEERRKEGRGRGKNKV-----GKAKKGGRDDN 196
>ICI1_CANLI (P81712) Subtilisin inhibitor CLSI-I| Length = 65 Score = 28.1 bits (61), Expect = 6.9 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +3 Query: 87 TSWPEVVGKSIEEAKEI 137 TSWPE+VG + EEA++I Sbjct: 5 TSWPELVGVTAEEAEKI 21
>IER1_LYCES (P20076) Ethylene-responsive proteinase inhibitor 1 precursor| (Ethylene-responsive proteinase inhibitor I) Length = 119 Score = 27.7 bits (60), Expect = 9.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 90 SWPEVVGKSIEEAKEIILKDMPE 158 SWPE++G + AK+II K+ P+ Sbjct: 58 SWPELLGTPAKFAKQIIQKENPK 80
>K1C9_HUMAN (P35527) Keratin, type I cytoskeletal 9 (Cytokeratin-9) (CK-9)| (Keratin-9) (K9) Length = 623 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 32 RIEDELRRPKSPRRRGEEDVMAGGSGKVHRGGQG 133 R+E E+ + G+ED + G+GK+ GG+G Sbjct: 446 RLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRG 479 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,959,556 Number of Sequences: 219361 Number of extensions: 174226 Number of successful extensions: 633 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)