| Clone Name | bastl25a08 |
|---|---|
| Clone Library Name | barley_pub |
>DNM3B_HUMAN (Q9UBC3) DNA (cytosine-5)-methyltransferase 3B (EC 2.1.1.37)| (Dnmt3b) (DNA methyltransferase HsaIIIB) (DNA MTase HsaIIIB) (M.HsaIIIB) Length = 853 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRHGLVLVAFFGDG 276 GD+VWGK+K WWP V S + + G R V +FGDG Sbjct: 226 GDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMR----WVQWFGDG 267
>DNM3B_MOUSE (O88509) DNA (cytosine-5)-methyltransferase 3B (EC 2.1.1.37)| (Dnmt3b) (DNA methyltransferase MmuIIIB) (DNA MTase MmuIIIB) (M.MmuIIIB) Length = 859 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRHGLVLVAFFGDG 276 GD+VWGK+K WWP V S + + G R V +FGDG Sbjct: 233 GDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMR----WVQWFGDG 274
>DNM3A_MOUSE (O88508) DNA (cytosine-5)-methyltransferase 3A (EC 2.1.1.37)| (Dnmt3a) (DNA methyltransferase MmuIIIA) (DNA MTase MmuIIIA) (M.MmuIIIA) Length = 908 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRHGLVLVAFFGDG 276 G++VWGK++ WWPG + S ++ G R V +FGDG Sbjct: 289 GELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTR----WVMWFGDG 330
>DNM3A_HUMAN (Q9Y6K1) DNA (cytosine-5)-methyltransferase 3A (EC 2.1.1.37)| (Dnmt3a) (DNA methyltransferase HsaIIIA) (DNA MTase HsaIIIA) (M.HsaIIIA) Length = 909 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRHGLVLVAFFGDG 276 G++VWGK++ WWPG + S ++ G R V +FGDG Sbjct: 290 GELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTR----WVMWFGDG 331
>MSH6_MOUSE (P54276) DNA mismatch repair protein MSH6 (MutS-alpha 160 kDa| subunit) (G/T mismatch-binding protein) (GTBP) (GTMBP) (p160) Length = 1358 Score = 36.2 bits (82), Expect = 0.022 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRHGLVLVAFFGD 273 GD+VW K++ +PWWP VY+ D + + + V V FF D Sbjct: 93 GDLVWAKMEGYPWWPCLVYNHPF-DGTFIRKKGKSVRVHVQFFDD 136
>MSH6_HUMAN (P52701) DNA mismatch repair protein MSH6 (MutS-alpha 160 kDa| subunit) (G/T mismatch binding protein) (GTBP) (GTMBP) (p160) Length = 1360 Score = 35.4 bits (80), Expect = 0.038 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYS 198 GD+VW K++ +PWWP VY+ Sbjct: 93 GDLVWAKMEGYPWWPCLVYN 112
>NSD1_HUMAN (Q96L73) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) (Androgen r Length = 2696 Score = 33.1 bits (74), Expect = 0.19 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYS 198 GD++W K K PWWP + S Sbjct: 324 GDLIWAKFKRRPWWPCRICS 343 Score = 28.9 bits (63), Expect = 3.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 121 GWTPRFGDMVWGKVKSHPWWPGHV 192 G P + ++VW KV + WWP + Sbjct: 1751 GKKPHYREIVWVKVGRYRWWPAEI 1774
>MES4_DROME (Q8MT36) Probable histone methyltransferase Mes-4 (Maternal-effect| sterile 4) Length = 1427 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +1 Query: 121 GWTPRFGDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRHGLVLVAFFG 270 G P +G++VW K + WWP + T + + + +V FFG Sbjct: 1044 GRLPLYGEIVWAKFNNFRWWPAIILPPTEVPSNILKKAHGENDFVVRFFG 1093 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 121 GW-TPRFGDMVWGKVKSHPWWP 183 GW T + GD+ WGKV S+ +WP Sbjct: 389 GWPTYQVGDLFWGKVFSYCFWP 410
>ZCPW1_HUMAN (Q9H0M4) Zinc finger CW-type PWWP domain protein 1| Length = 494 Score = 31.2 bits (69), Expect = 0.72 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYS 198 G ++W K +PWWPG + S Sbjct: 318 GSIIWAKQYGYPWWPGMIES 337
>ZCPW1_MOUSE (Q6IR42) Zinc finger CW-type PWWP domain protein 1 homolog| Length = 630 Score = 30.4 bits (67), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHV 192 G ++W K +PWWPG + Sbjct: 309 GSIIWAKQYGYPWWPGMI 326
>ATL4O_ARATH (Q8W571) RING-H2 finger protein ATL4O precursor| Length = 322 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -3 Query: 270 SEEGDEDEAMAVAAMHLRVVGEGEAVDVARPPRMRL 163 ++ GDED+ + +AAM VV + E V+VA+ RL Sbjct: 173 NKPGDEDDGVPLAAMRDHVVVDIETVEVAKSHHRRL 208
>NSD1_MOUSE (O88491) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) Length = 2588 Score = 28.9 bits (63), Expect = 3.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 121 GWTPRFGDMVWGKVKSHPWWPGHV 192 G P + ++VW KV + WWP + Sbjct: 1649 GKKPHYREIVWVKVGRYRWWPAEI 1672
>ATX1_ARATH (Q9C5X4) Histone-lysine N-methyltransferase, H3 lysine-4 specific| ATX1 (EC 2.1.1.43) (H3-K4-HMTase) (Trithorax-homolog protein 1) (TRX-homolog protein 1) (Protein SET DOMAIN GROUP 27) Length = 1062 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRH-----GLVLVAFFG 270 GD+VW K+ H WP + ++ + +G + G +LV FFG Sbjct: 302 GDIVWAKLAGHAMWPAVIVDESIIGE---RKGLNNKVSGGGSLLVQFFG 347
>CKLF6_PONPY (Q5RFC1) CKLF-like MARVEL transmembrane domain-containing protein 6| (Chemokine-like factor superfamily member 6) Length = 183 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 184 GHVYSLTLSDDPEVHRGYRHGLVLVAFFG 270 G VYS T +DP RG R GL F G Sbjct: 4 GAVYSPTTEEDPGPARGPRSGLAAYCFLG 32
>MBD5_HUMAN (Q9P267) Methyl-CpG-binding domain protein 5 (Methyl-CpG-binding| protein MBD5) Length = 1494 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPG 186 GD+VWG++K WPG Sbjct: 1386 GDLVWGQIKGLTSWPG 1401
>YAE1_SCHPO (Q09842) Hypothetical PWWP domain protein C23D3.01| Length = 407 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHVYS 198 G+ V K+ S PWWP V S Sbjct: 64 GEYVLAKMSSFPWWPARVAS 83
>TRI5_FUSPS (Q8NID7) Trichodiene synthase (EC 4.2.3.6) (Sesquiterpene cyclase)| (TS) Length = 375 Score = 27.7 bits (60), Expect = 7.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 136 FGDMVWGKVKSHPWW 180 FGD+ G+ ++HPWW Sbjct: 114 FGDLQAGREQAHPWW 128
>TNSE_ECOLI (P05845) Transposon Tn7 transposition protein tnsE (Protein D)| Length = 538 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 112 DSEGWTPRFGDMVWGKVKSHPWWPGHVYSLTLSDDPEVHRGYRH 243 DSE W F + G VKS WP ++ D HRG H Sbjct: 469 DSETWRNDFEKIRRGVVKSSLNWPNSLFDQLYGQDG--HRGVNH 510
>PTN23_HUMAN (Q9H3S7) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) (His-domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) Length = 1636 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 207 EGEAVDVARPPRMRLHLAPDHVAKPRGP 124 E EAV+ PP L PD VA PR P Sbjct: 732 ESEAVEAGDPPEELRSLPPDMVAGPRLP 759
>GLGA_SYNPX (Q7U7I2) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 513 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 207 EGEAVDVARPPRMRLHLAPDHVAKPRGPT 121 +G+A D +RP ++ AP+ V P GP+ Sbjct: 472 QGQAADPSRPEDDAINAAPEAVTAPSGPS 500
>ATM_ARATH (Q9M3G7) Serine/threonine-protein kinase ATM (EC 2.7.11.1) (Ataxia| telangiectasia mutated homolog) (AtATM) Length = 3856 Score = 27.7 bits (60), Expect = 7.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 139 GDMVWGKVKSHPWWPGHV 192 G++VW K WWPG V Sbjct: 109 GNLVWVMTKYKKWWPGEV 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,116,213 Number of Sequences: 219361 Number of extensions: 601286 Number of successful extensions: 1839 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1839 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)