| Clone Name | bastl25a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LTBP2_BOVIN (Q28019) Latent transforming growth factor beta-bind... | 29 | 2.5 | 2 | IF2_RHOS4 (Q3IYN5) Translation initiation factor IF-2 | 28 | 5.5 | 3 | YAG3_SCHPO (Q09868) Hypothetical RNA-binding protein C12G12.03 i... | 28 | 5.5 | 4 | AGLB_KLEPN (Q9AGA6) 6-phospho-alpha-glucosidase (EC 3.2.1.122) | 28 | 7.2 |
|---|
>LTBP2_BOVIN (Q28019) Latent transforming growth factor beta-binding protein 2| precursor (LTBP-2) Length = 1842 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +2 Query: 32 KNESFPATRRPAPRRSLADSPPSLR 106 + E P RPAPRRS A+ PPSLR Sbjct: 218 EEEFDPQNSRPAPRRS-AEGPPSLR 241
>IF2_RHOS4 (Q3IYN5) Translation initiation factor IF-2| Length = 836 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 32 KNESFPATRRPAPRRSLADSPPSLRLKEP*ARRTR 136 K PA +PAP S A +PPS + P +R+ R Sbjct: 155 KRAPAPAAPQPAPAESRASAPPSAKPGLPPSRKER 189
>YAG3_SCHPO (Q09868) Hypothetical RNA-binding protein C12G12.03 in chromosome I| Length = 576 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 17 FPSWEKNESFPATRRPAPRRSLADSPPSLR 106 F S + +F + RRPAP LADS SLR Sbjct: 474 FSSGGLSSNFSSLRRPAPSMHLADSIRSLR 503
>AGLB_KLEPN (Q9AGA6) 6-phospho-alpha-glucosidase (EC 3.2.1.122)| Length = 440 Score = 27.7 bits (60), Expect = 7.2 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 17/84 (20%) Frame = +2 Query: 23 SWEKNESFPA------TRRPAPRR---SLADSPPSLR--------LKEP*ARRTRFYPAF 151 +W N S PA TRR P ++ D P + LK+ R R+Y Sbjct: 140 AWMLNYSNPAAIVAEATRRLRPNAKILNICDMPIGIEGRMAQIVGLKDRKQMRVRYY--- 196 Query: 152 PSGISHLDWALKMRSSRGEDIMPR 223 G++H W + G D+MP+ Sbjct: 197 --GLNHFGWWTSIEDLDGNDLMPK 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,431,802 Number of Sequences: 219361 Number of extensions: 724157 Number of successful extensions: 1671 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1671 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)