| Clone Name | bastl24h09 |
|---|---|
| Clone Library Name | barley_pub |
>HSF_XENLA (P41154) Heat shock factor protein (HSF) (Heat shock transcription| factor) (HSTF) Length = 451 Score = 33.5 bits (75), Expect = 0.17 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Frame = +2 Query: 8 SYPIQ---KSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 SYP+ SSA P+I+ ++ LP++S PSP P P ++PSP Sbjct: 236 SYPVSGFTDSSAGPIISDVTELPESS---PSPSPCPSLEASPSP 276
>STK39_RAT (O88506) STE20/SPS1-related proline-alanine-rich protein kinase (EC| 2.7.11.1) (Ste-20-related kinase) (Serine/threonine-protein kinase 39) (Pancreatic serine/threonine-protein kinase) (PS/TK) (PSTK1) Length = 553 Score = 32.0 bits (71), Expect = 0.49 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 32 APPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 A P+ A + P +T +P+P PAP P+AP+P Sbjct: 17 AAPVTAAAA-APAAATSAPAPAPAPAAPAAPAP 48
>AB1IP_BRARE (Q6PFT9) Amyloid beta A4 precursor protein-binding family B member| 1-interacting protein (APBB1-interacting protein 1) Length = 646 Score = 32.0 bits (71), Expect = 0.49 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 P +SS PP + FLP D P P P P+ P+P Sbjct: 459 PSNQSSLPPPPPSMDFLPPPPPDPMFPPPPPAPPAPPAP 497
>GUNA_MICBI (P26414) Endoglucanase A precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) Length = 456 Score = 31.6 bits (70), Expect = 0.64 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +2 Query: 8 SYPIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 +Y + ++APP ++ P + +PSP P+ +P +PSP Sbjct: 314 AYELAMNAAPP-----TYSPSPTPSTPSPSPSQSDPGSPSP 349
>CO4B_HUMAN (P0C0L5) Complement C4-B precursor (Basic complement C4) [Contains:| Complement C4 beta chain; Complement C4-B alpha chain; C4a anaphylatoxin; C4b-B; C4d-B; Complement C4 gamma chain] Length = 1744 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 71 TSTDSPSPCPAPRNPSAPSPQ 133 + +++ SP PAPRNPS P PQ Sbjct: 1236 SQSNAVSPTPAPRNPSDPMPQ 1256
>CO4A_HUMAN (P0C0L4) Complement C4-A precursor (Acidic complement C4) [Contains:| Complement C4 beta chain; Complement C4-A alpha chain; C4a anaphylatoxin; C4b-A; C4d-A; Complement C4 gamma chain] Length = 1744 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 71 TSTDSPSPCPAPRNPSAPSPQ 133 + +++ SP PAPRNPS P PQ Sbjct: 1236 SQSNAVSPTPAPRNPSDPMPQ 1256
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 30.8 bits (68), Expect = 1.1 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +2 Query: 14 PIQKSSAPPLIACL---SFLPKTSTDSPSPCPAPRNPSAPSP 130 P+ S APP A S P T + SPSP P+P +PSP Sbjct: 320 PVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSP 361 Score = 30.4 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 P S APP A S P + P PAP +PS P+P Sbjct: 96 PAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAP 134 Score = 29.3 bits (64), Expect = 3.2 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 P S APP A S P + P PAP +P+ PSP Sbjct: 53 PAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSP 91 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 P S APP S P + P PAP +P+ PSP Sbjct: 58 PAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSP 96 Score = 28.1 bits (61), Expect = 7.1 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 P S APP A S P + P P+P P +PSP Sbjct: 101 PAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSP 139
>SF3A1_MOUSE (Q8K4Z5) Splicing factor 3 subunit 1 (SF3a120)| Length = 791 Score = 30.4 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 PI PP+I +F+P +P P PAP P P P Sbjct: 635 PIMAPRPPPMIVPTAFVPAPPV-APVPAPAPMPPVHPPP 672
>SF3A1_HUMAN (Q15459) Splicing factor 3 subunit 1 (Spliceosome-associated| protein 114) (SAP 114) (SF3a120) Length = 793 Score = 30.4 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 PI PP+I +F+P +P P PAP P P P Sbjct: 637 PIMAPRPPPMIVPTAFVPAPPV-APVPAPAPMPPVHPPP 674
>SFPQ_HUMAN (P23246) Splicing factor, proline- and glutamine-rich| (Polypyrimidine tract-binding protein-associated splicing factor) (PTB-associated splicing factor) (PSF) (DNA-binding p52/p100 complex, 100 kDa subunit) (100-kDa DNA-pairing protein) (hPOMp Length = 707 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 8 SYPIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAP 124 S P SSAPP S P S P+P P P SAP Sbjct: 123 SAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAP 161
>GDA6_WHEAT (P04726) Alpha/beta-gliadin clone PW1215 precursor (Prolamin)| Length = 296 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 41 LIACLSFLPKTSTDSPSPCPAPRNPSAPSPQ 133 L+A ++ T+ P P P P+NPS P PQ Sbjct: 9 LLAIVATTATTAVRVPVPQPQPQNPSQPQPQ 39
>PRDM2_HUMAN (Q13029) PR domain zinc finger protein 2 (PR domain-containing| protein 2) (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) (MTE-binding protein) (MTB-ZF) (GATA-3-binding protein G3B) Length = 1718 Score = 29.6 bits (65), Expect = 2.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 35 PPLIACLSFLPKTSTDSPSPCPAP-RNPSAPSP 130 PPL+ + +S+ SP PCP+P N +A SP Sbjct: 987 PPLLPTVPLPAPSSSASPHPCPSPLSNATAQSP 1019
>HXA5_HUMAN (P20719) Homeobox protein Hox-A5 (Hox-1C)| Length = 270 Score = 29.3 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 65 PKTSTDSPSPCPAPRNPSAPSP 130 P TST SP P P P + APSP Sbjct: 89 PATSTHSPQPDPLPCSAVAPSP 110
>BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231)| Length = 3925 Score = 29.3 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 3/22 (13%) Frame = +2 Query: 74 STDSPSPCPA---PRNPSAPSP 130 ST +PSP PA PR+P AP+P Sbjct: 1504 STQTPSPAPASDMPRSPGAPTP 1525
>SSGP_VOLCA (P21997) Sulfated surface glycoprotein 185 precursor (SSG 185)| Length = 485 Score = 29.3 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 65 PKTSTDSPSPCPAPRNPSAPSP 130 P S+ PSP P+PR PS P P Sbjct: 235 PTASSRPPSPPPSPRPPSPPPP 256
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 29.3 bits (64), Expect = 3.2 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 Query: 29 SAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 S PP ++ LS LP S SP P +P +P A SP Sbjct: 645 SPPPEVSRLSPLPVVSRLSPPPEESPLSPPALSP 678
>CHEB2_PSEF5 (Q4KG36) Chemotaxis response regulator protein-glutamate| methylesterase 2 (EC 3.1.1.61) Length = 373 Score = 29.3 bits (64), Expect = 3.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 5 YSYPIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPS 127 YS P + ++ P A SF S+ SP+P PAP +AP+ Sbjct: 139 YSAPAPQPASAPAPAPSSF---ASSRSPAPAPAPARAAAPA 176
>HXA5_MOUSE (P09021) Homeobox protein Hox-A5 (Hox-1.3) (M2)| Length = 270 Score = 28.9 bits (63), Expect = 4.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 65 PKTSTDSPSPCPAPRNPSAPSP 130 P TST SP P P P + APSP Sbjct: 89 PATSTHSPPPDPLPCSAVAPSP 110
>NCOR2_HUMAN (Q9Y618) Nuclear receptor corepressor 2 (N-CoR2) (Silencing| mediator of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) (CTG repeat p Length = 2517 Score = 28.9 bits (63), Expect = 4.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 74 STDSPSPCPAPRNPSAPSP 130 +T +P+P PAP +PSAP P Sbjct: 802 ATGAPTPPPAPPSPSAPPP 820
>STK39_MOUSE (Q9Z1W9) STE20/SPS1-related proline-alanine-rich protein kinase (EC| 2.7.11.1) (Ste-20-related kinase) (Serine/threonine-protein kinase 39) Length = 556 Score = 28.5 bits (62), Expect = 5.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 32 APPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 A P+ A + P +T +P+P PAP ++ +P Sbjct: 17 AAPVTAAAATAPAAATSAPAPAPAPAPAASAAP 49
>ATX2L_MOUSE (Q7TQH0) Ataxin-2-like protein| Length = 1049 Score = 28.5 bits (62), Expect = 5.4 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSP----SPCPAPRNPSAPSP 130 P ++S PP A L FLP P S PAP + S P P Sbjct: 427 PSGEASVPPTSAALPFLPVGRMYPPRSPKSAAPAPVSASCPEP 469
>WNK4_MOUSE (Q80UE6) Serine/threonine-protein kinase WNK4 (EC 2.7.11.1)| (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) Length = 1222 Score = 28.1 bits (61), Expect = 7.1 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 11 YPIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAP 124 YP SS PL + S +P S+ P P P +PS P Sbjct: 842 YPQAPSSLLPLSSSASQVPLPSSSLPISAPLPFSPSYP 879
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 28.1 bits (61), Expect = 7.1 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 2 GYSYPIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 G P K +PPL ACLS +P PAP PSP Sbjct: 1096 GLCLPSPKPGSPPLCACLSGFGGPDCLTP---PAPPGCGPPSP 1135
>Y091_NPVAC (P41479) Hypothetical 24.1 kDa protein in LEF4-P33 intergenic| region Length = 224 Score = 28.1 bits (61), Expect = 7.1 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +2 Query: 14 PIQKSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSP 130 P S PP S +P T T SP P P P P+ PSP Sbjct: 100 PTPTPSPPP-----SPIPPTPTPSPPPSPIPPTPT-PSP 132
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 28.1 bits (61), Expect = 7.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 83 SPSPCPAPRNPSAPSPQ 133 SPSP P+P P APSP+ Sbjct: 88 SPSPKPSPPKPPAPSPK 104 Score = 27.7 bits (60), Expect = 9.2 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 26 SSAPPLIACLSFLPKTSTD---SPSPCPAPRNPSAPSP 130 S AP + S PK S +PSP P+P P APSP Sbjct: 78 SPAPKPVPPPSPSPKPSPPKPPAPSPKPSPPKPPAPSP 115
>SPR2K_MOUSE (O70562) Small proline-rich protein 2K| Length = 68 Score = 27.7 bits (60), Expect = 9.2 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 23 KSSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSPQ 133 K PL C P + P PCP P+ P PQ Sbjct: 9 KQLCQPLPVCPPPKPCSPPKCPEPCPPPKCPETCPPQ 45
>GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E1) (Cellulase E1) (Endocellulase E1) Length = 562 Score = 27.7 bits (60), Expect = 9.2 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 2 GYSYPIQKSSAPPLIACLSFLPKTSTD-SPSPCPAPRNPSAPSP 130 GY PI+ S P+ A S + S SPSP P+P P+P Sbjct: 386 GYLAPIKSSIFDPVGASASPSSQPSPSVSPSPSPSPSASRTPTP 429
>PCL_DROME (Q24459) Polycomb protein Pcl (Polycomblike protein)| Length = 1043 Score = 27.7 bits (60), Expect = 9.2 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 18/59 (30%) Frame = +2 Query: 8 SYPIQKSSAPPLIACLSFL----------------PKTSTDSPSPCPAPRNP--SAPSP 130 S P + S +PPL+A S L P T PSP P P P +APSP Sbjct: 289 SSPGKSSPSPPLLATQSLLKGVNSMKPSFKTVEAAPPTPPTPPSPPPPPPAPPVAAPSP 347
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 27.7 bits (60), Expect = 9.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 86 PSPCPAPRNPSAPSPQ 133 P PCP+P P AP+P+ Sbjct: 152 PVPCPSPPKPPAPTPK 167
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 27.7 bits (60), Expect = 9.2 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 5 YSYPIQK--SSAPPLIACLSFLPKTSTDSPSPCPAPRNPSAPSPQ 133 YS PIQ+ S +PP PK T SP P P R ++PSPQ Sbjct: 589 YSPPIQRRYSPSPP--------PKRRTASPPPPPKRR--ASPSPQ 623
>ATBF1_HUMAN (Q15911) Alpha-fetoprotein enhancer-binding protein (AT motif-binding| factor) (AT-binding transcription factor 1) Length = 3703 Score = 27.7 bits (60), Expect = 9.2 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Frame = +2 Query: 14 PIQKSSAP----PLIACLSFLPKTSTDSPSP-CPAPRNPSAPS 127 P QK++ P P + L LP+ +P P CP P++ +PS Sbjct: 2460 PEQKTNTPQQKLPQLVSLPSLPQPPPQAPPPQCPLPQSSPSPS 2502
>NO551_SOYBN (Q05544) Early nodulin 55-1 (N-55-1) (Fragment)| Length = 137 Score = 27.7 bits (60), Expect = 9.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 65 PKTSTDSPSPCPAPRNPSAPSP 130 P S+ SPSP P+P +PSP Sbjct: 78 PSPSSPSPSPSPSPSPSPSPSP 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,537,750 Number of Sequences: 219361 Number of extensions: 275772 Number of successful extensions: 3396 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 2294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3221 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)