| Clone Name | bastl24f05 |
|---|---|
| Clone Library Name | barley_pub |
>MURC_CHLTE (Q8KGD5) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 475 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 146 PPVGRRYRPVGSDDSAVVQMTSMEPAPGGST 238 P + RRY G ++ A V + +EP GGST Sbjct: 231 PRLNRRYTTFGIEEHADVMASEIEPGDGGST 261
>NFAC3_MOUSE (P97305) Nuclear factor of activated T-cells, cytoplasmic 3| (NF-ATc3) (NFATc3) (T cell transcription factor NFAT4) (NF-AT4) (NFATx) Length = 1075 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 122 EEGLPMPAPPVGRRYRPVGSDDSAVVQMTSMEPAPGGSTS 241 E+G P P PP G R + DD A + + +++P P T+ Sbjct: 20 EDGAPAPPPP-GSRPADLEPDDCASIYIFNVDPPPSTLTT 58
>NFAC3_HUMAN (Q12968) Nuclear factor of activated T-cells, cytoplasmic 3| (NF-ATc3) (NFATc3) (T cell transcription factor NFAT4) (NF-AT4) (NFATx) Length = 1075 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 122 EEGLPMPAPPVGRRYRPVGSDDSAVVQMTSMEPAPGGSTS 241 E+G P P PP G R + DD A + + +++P P T+ Sbjct: 20 EDGAPAPPPP-GSRPADLEPDDCASIYIFNVDPPPSTLTT 58
>PMP1_CHLPN (Q9Z9G5) Probable outer membrane protein pmp1 precursor| (Polymorphic membrane protein 1) (Outer membrane protein 6) Length = 922 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 149 PVGRRYRPVGSDDSAVVQMTSMEPAPGGSTSVT 247 P G Y + +S + S+EP GGS +VT Sbjct: 515 PTGNAYEDLRMRNSQTFPLLSLEPGAGGSVTVT 547
>CORO_CAEEL (Q21624) Coronin-like protein cor-1| Length = 605 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 134 PMPAPPVGRRYRPVGSDDSAVVQMTSMEPAPGGSTSVTGHE 256 P P P R RPV DD +V M P+ S+ + E Sbjct: 436 PSPRPSASPRPRPVVDDDMGIVTMREAPPSRPASSRASRTE 476
>PEO1_HUMAN (Q96RR1) Twinkle protein, mitochondrial precursor (EC 3.6.1.-) (T7| gp4-like protein with intramitochondrial nucleoid localization) (T7-like mitochondrial DNA helicase) (Progressive external ophthalmoplegia 1 protein) Length = 684 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 178 PHGTVPAPDGRRRHRQPLLRGLDLPVL 98 P P P RRR+R+ L+ LD+PVL Sbjct: 28 PRNLAPGPP-RRRYRKETLQALDMPVL 53
>IRS2_MOUSE (P81122) Insulin receptor substrate 2 (IRS-2) (4PS)| Length = 1321 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 1 PAPPRSSPASDQPLYHRRSERPTLPVETAS 90 P PP S P PL+H + +RP+ +AS Sbjct: 457 PLPPGSHPHLPHPLHHPQGQRPSSGSASAS 486 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.129 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,523,199 Number of Sequences: 219361 Number of extensions: 366125 Number of successful extensions: 1272 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1271 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)