| Clone Name | bastl24b12 |
|---|---|
| Clone Library Name | barley_pub |
>CXA3_RAT (P29414) Gap junction alpha-3 protein (Connexin-46) (Cx46)| Length = 415 Score = 29.3 bits (64), Expect = 2.5 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -3 Query: 344 LRRQRNQAHGRGRQGSRPGSAQAPELPALAIRRTGGVRLAG 222 L R+ N HGRGR+ R GS + P L G VR+AG Sbjct: 112 LLRRDNPQHGRGREPMRTGSPRDPPLR----DDRGKVRIAG 148
>CXA3_MOUSE (Q64448) Gap junction alpha-3 protein (Connexin-46) (Cx46)| Length = 416 Score = 29.3 bits (64), Expect = 2.5 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -3 Query: 344 LRRQRNQAHGRGRQGSRPGSAQAPELPALAIRRTGGVRLAG 222 L R+ N HGRGR+ R GS + P L G VR+AG Sbjct: 112 LLRRDNPQHGRGREPMRTGSPRDPPLR----DDRGKVRIAG 148
>RF1_ORYSA (Q76C99) Rf1 protein, mitochondrial precursor (PPR protein)| (Fertility restorer) (Restorer for CMS) Length = 791 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +2 Query: 206 RAGTLSRQDAHHLFDELLGQATPVPERYLDGFLAALARAPDSSA 337 RAG +DA H+FDELL + L+ LA +AR ++A Sbjct: 25 RAGGSGAEDARHVFDELLRRGRGASIYGLNRALADVARDSPAAA 68
>ZDH23_RAT (Q76IC6) Probable palmitoyltransferase ZDHHC23 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 23) (DHHC-23) (NNOS-interacting DHHC domain-containing protein with dendritic mRNA) Length = 429 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 282 SGTGVACPSNSSNRWCASCRLRVPAR 205 S G+ P+ S WCA C++ PAR Sbjct: 240 SRVGLDSPAKSKEDWCAKCQVVRPAR 265
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 257 LGQATPVPERYLDGFLAALARAPDSS 334 LG A P P++YL+G APD S Sbjct: 7 LGDAQPNPDKYLEGAAGQQPTAPDKS 32
>NPT2B_PONPY (Q5REV9) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 689 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 257 LGQATPVPERYLDGFLAALARAPDSS 334 LG A P P++YL+G APD S Sbjct: 7 LGDAQPNPDKYLEGAAGQQPTAPDKS 32
>GLT5_WHEAT (P10388) Glutenin, high molecular weight subunit DX5 precursor| Length = 839 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 335 QRNQAHGRGRQGSRPGSAQAPELPA 261 Q+ Q G+G+QG +PG Q + PA Sbjct: 589 QQGQQLGQGQQGQQPGQGQQGQQPA 613 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,277,056 Number of Sequences: 219361 Number of extensions: 473420 Number of successful extensions: 1761 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1761 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)