| Clone Name | bastl24a06 |
|---|---|
| Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 37.0 bits (84), Expect = 0.011 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +1 Query: 295 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTS 405 +LE+ V R + D + R ALE +R++IRS+T+SMTS Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTS 91
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 37.0 bits (84), Expect = 0.011 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +1 Query: 295 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTS 405 +LE+ V R + D + R ALE +R++IRS+T+SMTS Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTS 91
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +1 Query: 298 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTS 405 LEL V R ++ D + +L ++++ I+++TSSMT+ Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTA 83
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 298 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTS 405 LEL V QD P + +L +++ IR++TSSMT+ Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTA 92
>ANLN_DROME (Q9V4P1) Actin-binding protein anillin (Actin-binding protein 8)| (ABP8) Length = 1239 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPVSAVA 112 S + + + P A APSR+ PP P P++A++ Sbjct: 498 SDSSVAAQARPPAPAPSRVVRPMPPPPPPPIAALS 532
>CHS4_NEUCR (Q01285) Chitin synthase 4 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 4) (Class-IV chitin synthase 4) Length = 1195 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 8/39 (20%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPS--------APSPNRIRPA 131 P+QQ+RV S+ P TL SP+ AP+P P+ Sbjct: 6 PSQQQRVPSISSFPETLPSPNPNVERDPLAPTPEPAHPS 44
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +1 Query: 322 QDVDPGVQRLALESMRQEIRSATSSMTS 405 Q+ D + + ALE+M+ I+++TSSMT+ Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTA 75
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPSAPS-PNRIRPASH 137 PT ++ A +PL P A P+ P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.305 0.124 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,023,380 Number of Sequences: 219361 Number of extensions: 309123 Number of successful extensions: 782 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)