| Clone Name | bastl23g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MT4_MOUSE (P47945) Metallothionein-4 (MT-4) (Metallothionein-IV)... | 28 | 6.5 | 2 | SYGP1_RAT (Q9QUH6) Ras GTPase-activating protein SynGAP (Synapti... | 28 | 8.5 | 3 | Y678_DROME (Q8T053) Hypothetical zinc finger protein CG2678 in c... | 28 | 8.5 | 4 | SYGP1_HUMAN (Q96PV0) Ras GTPase-activating protein SynGAP (Synap... | 28 | 8.5 |
|---|
>MT4_MOUSE (P47945) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 74 CWCGASSMSWCRTRCVTCSSPAWATFARTC 163 C C S CR C C P A AR C Sbjct: 20 CKCTTCSCKTCRKSCCPCCPPGCAKCARGC 49
>SYGP1_RAT (Q9QUH6) Ras GTPase-activating protein SynGAP (Synaptic| Ras-GTPase-activating protein 1) (Synaptic Ras-GAP 1) (Neuronal RasGAP) (p135 SynGAP) Length = 1293 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 138 HGLPSLAHVLPAHHHHRGDRGVG 206 HG PS H HHHHRG G Sbjct: 936 HGPPSSHHHHHHHHHHRGGEPPG 958
>Y678_DROME (Q8T053) Hypothetical zinc finger protein CG2678 in chromosome 3| Length = 434 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 82 RGVVNELVPYEVCDLLFSGMGYLRSHMSSQHT 177 RG + +L E C L+F + YLR H H+ Sbjct: 397 RGHMGDLFRCEFCSLVFVDVNYLRKHKKRIHS 428
>SYGP1_HUMAN (Q96PV0) Ras GTPase-activating protein SynGAP (Synaptic| Ras-GTPase-activating protein 1) (Synaptic Ras-GAP 1) (Neuronal RasGAP) Length = 1328 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 138 HGLPSLAHVLPAHHHHRGDRGVG 206 HG PS H HHHHRG G Sbjct: 936 HGPPSSHHHHHHHHHHRGGEPPG 958 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,268,829 Number of Sequences: 219361 Number of extensions: 323521 Number of successful extensions: 1045 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)