| Clone Name | bastl23b11 |
|---|---|
| Clone Library Name | barley_pub |
>YFF9_SCHPO (O14066) Hypothetical serine-rich protein C1687.09 in chromosome I| Length = 1379 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = +1 Query: 70 QKVDAAAFCRDQKSYYHQNSFKIPIRETSAATTTHKAPGGV*GSTRFGQQPWFHSPAQLT 249 Q ++AA + Q Y+HQ+S ++PI + A + + S+ + H P+ + Sbjct: 508 QALNAAILNKTQLPYFHQSSSELPISASKRAALSQQTESASKSSSNISEMCDSHPPSNFS 567 Query: 250 L 252 + Sbjct: 568 I 568
>GRIP2_RAT (Q9WTW1) Glutamate receptor-interacting protein 2 (GRIP2 protein)| (AMPA receptor-interacting protein GRIP2) Length = 1043 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/74 (25%), Positives = 32/74 (43%) Frame = +2 Query: 23 AEHGQGHELSVCSVSPKRWTLLHSVGIRSHIIIKIPSRFQSERRAQQRRPTKRPGEFRVQ 202 A H H L++ S + +L+ + + + + K+ R + Q RRP K P R+Q Sbjct: 295 ALHAGDHILAIDGTSTEHCSLVEATKLLASVTEKV--RLEILPAPQSRRPLKPPEAVRIQ 352 Query: 203 LGLDSSHGSTLLPS 244 H +PS Sbjct: 353 RSEQLHHWDPCVPS 366
>IL3RB_MOUSE (P26955) Cytokine receptor common beta chain precursor| (GM-CSF/IL-3/IL-5 receptor common beta-chain) (CD131 antigen) Length = 896 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 170 PTKRPGEFRVQLGLDSSHGSTLLPSSRLDGFCFL 271 PT PGE R ++G S H LL ++ +CFL Sbjct: 791 PTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFL 824
>IL3B2_MOUSE (P26954) Interleukin-3 receptor class 2 beta chain precursor| (Interleukin-3 receptor class II beta chain) (Colony-stimulating factor 2 receptor, beta 2 chain) Length = 878 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 170 PTKRPGEFRVQLGLDSSHGSTLLPSSRLDGFCFL 271 PT PGE R ++G S H LL ++ +CFL Sbjct: 791 PTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFL 824
>KR1_VZVD (P09251) Serine/threonine-protein kinase ORF66 (EC 2.7.11.1)| Length = 393 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +2 Query: 110 HIIIKIPSRFQSERRAQQRRPTKRPGEFRVQLGLDSSHGST--LLPSSRLDGFCFLM*RR 283 H++IK R + A R P +++ G + + T +LP R D +C+L +R Sbjct: 118 HVVIKAGQRQGTATEATVLRALTHPSVVQLK-GTFTYNKMTCLILPRYRTDLYCYLAAKR 176 Query: 284 RVPMC 298 +P+C Sbjct: 177 NLPIC 181
>OTP_PARLI (O76971) Homeobox protein orthopedia-related (PLOTP)| Length = 364 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 149 RRAQQRRPTKRPGEFRVQLGLDSSHGSTLLPSSRLDGFC 265 RRA+ ++ K FR L SHG PS D FC Sbjct: 167 RRAKWKKRKKTTNVFRTPGALLPSHGLAQFPSPMNDSFC 205
>OXLA_HUMAN (Q96RQ9) L-amino-acid oxidase precursor (EC 1.4.3.2) (LAAO)| (Interleukin-4-induced protein 1) (IL4-induced protein 1) (Protein Fig-1) (hFIG1) Length = 567 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 77 WTLLHSVGIRSHIIIKIPSRFQSERRAQQR 166 WT +H V +R++++ K+P + R Q++ Sbjct: 146 WTEVHEVKLRNYVVEKVPEKLGYALRPQEK 175
>RBD2_YEAST (Q12270) Rhomboid protein 2 (EC 3.4.21.-)| Length = 262 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 220 PWFHSPAQLTLGWILFLDVASACAYVFAL 306 P H PA LT G ++FL +++FAL Sbjct: 9 PGGHPPAALTTGLVVFLTAIYLLSFIFAL 37
>Y2073_MYCBO (P65685) Hypothetical protein Mb2073c| Length = 854 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 124 FDDNMTSDPYRMQQRPPFGGDRANRELMALPVLGVF 17 F +M S P QRPP RA R L L +GVF Sbjct: 402 FGPSMASLPIFGAQRPPSESSRARRWLRTLRNIGVF 437
>Y2047_MYCTU (P65684) Hypothetical protein Rv2047c/MT2107| Length = 854 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 124 FDDNMTSDPYRMQQRPPFGGDRANRELMALPVLGVF 17 F +M S P QRPP RA R L L +GVF Sbjct: 402 FGPSMASLPIFGAQRPPSESSRARRWLRTLRNIGVF 437 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,809,076 Number of Sequences: 219361 Number of extensions: 837578 Number of successful extensions: 2382 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2382 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)