| Clone Name | bastl22h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SEM4G_HUMAN (Q9NTN9) Semaphorin-4G precursor | 29 | 3.6 | 2 | SODC2_BRAJU (Q42612) Superoxide dismutase [Cu-Zn] 2 (EC 1.15.1.1) | 29 | 3.6 | 3 | NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 pr... | 28 | 4.7 | 4 | TBC12_HUMAN (O60347) TBC1 domain family member 12 | 28 | 6.1 | 5 | PP2CG_BOVIN (P79126) Protein phosphatase 2C isoform gamma (EC 3.... | 28 | 8.0 |
|---|
>SEM4G_HUMAN (Q9NTN9) Semaphorin-4G precursor| Length = 838 Score = 28.9 bits (63), Expect = 3.6 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +3 Query: 30 CRVQSTLHNRSACCSTVCRGSNGNGS---TDPPPPCLTPRV 143 C +T+ NR+A + RG+ G S T PPPP T V Sbjct: 534 CAAATTIANRTALIQDIERGNRGCESSRDTGPPPPLKTRSV 574
>SODC2_BRAJU (Q42612) Superoxide dismutase [Cu-Zn] 2 (EC 1.15.1.1)| Length = 151 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 246 PHERPEGEQRGVIRDASGSGSGLGCVVQGVSG 151 PH P+G+Q G DA+ LG ++ G G Sbjct: 60 PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDG 91
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 69 CSTVCRGSNGNGSTDP-PPPCLTP 137 C V G+ G+ S P PPPCLTP Sbjct: 1951 CDWVALGACGSASNIPIPPPCLTP 1974
>TBC12_HUMAN (O60347) TBC1 domain family member 12| Length = 769 Score = 28.1 bits (61), Expect = 6.1 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -3 Query: 246 PHERPEGEQRGVIRDASGSGSGLGCVVQGVSGDGAREE*DKEEE 115 P P G+ R VIR G G G+G V EE D+EEE Sbjct: 21 PAPDPVGQDRKVIRATGGFGGGVGAV-------EPPEEADEEEE 57
>PP2CG_BOVIN (P79126) Protein phosphatase 2C isoform gamma (EC 3.1.3.16)| (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) (Protein phosphatase 1B) (Magnesium-dependent calcium inhibitable phosphatase) (MCPP) Length = 543 Score = 27.7 bits (60), Expect = 8.0 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = -3 Query: 219 RGVIRDASGSGSGLGCVVQGVSGDGAREE*DKEEEGQXXXXXXCPGRRYCSKQSDCGVWT 40 +G SG+G+G QG++G+ E+ +E + S S+CG Sbjct: 166 KGAPHSKSGAGTGEEPGSQGLNGEAGPEDPSRETSAE-VNGPTAKAHTGLSSNSECGTEA 224 Query: 39 GRGKE 25 G+G E Sbjct: 225 GQGGE 229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,811,987 Number of Sequences: 219361 Number of extensions: 429702 Number of successful extensions: 1766 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1763 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)