| Clone Name | bastl21b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DNJBC_MOUSE (Q9QYI4) DnaJ homolog subfamily B member 12 (mDJ10) | 30 | 4.7 | 2 | DNJBC_HUMAN (Q9NXW2) DnaJ homolog subfamily B member 12 | 29 | 6.2 |
|---|
>DNJBC_MOUSE (Q9QYI4) DnaJ homolog subfamily B member 12 (mDJ10)| Length = 376 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 249 MECNREEASRAREIAVKKLENKDFVGARKIALKAQILFP 365 ME N++EA R IA+K +++ A + KAQ L+P Sbjct: 1 MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYP 39
>DNJBC_HUMAN (Q9NXW2) DnaJ homolog subfamily B member 12| Length = 375 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 249 MECNREEASRAREIAVKKLENKDFVGARKIALKAQILFP 365 ME N++EA R IA+K +++ A + KAQ L+P Sbjct: 1 MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYP 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,572,348 Number of Sequences: 219361 Number of extensions: 1173929 Number of successful extensions: 3208 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3208 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)