| Clone Name | bastl20h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ENPL_HORVU (P36183) Endoplasmin homolog precursor (GRP94 homolog) | 69 | 5e-12 | 2 | ENPL_ARATH (Q9STX5) Endoplasmin homolog precursor (GRP94 homolog... | 43 | 3e-04 | 3 | ENPL_CATRO (P35016) Endoplasmin homolog precursor (GRP94 homolog) | 33 | 0.29 | 4 | YW60_CAEEL (Q22634) Hypothetical protein T21C12.3 | 28 | 9.3 |
|---|
>ENPL_HORVU (P36183) Endoplasmin homolog precursor (GRP94 homolog)| Length = 809 Score = 68.6 bits (166), Expect = 5e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 TLPDPAKKLQVNAEESGDEVGDFPKLEEKLGAVP 102 TLPDPAKKLQVNAEES DEVGDFPK+EEKLGAVP Sbjct: 18 TLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVP 51
>ENPL_ARATH (Q9STX5) Endoplasmin homolog precursor (GRP94 homolog) (Protein| SHEPHERD) (HSP90-like protein 7) Length = 823 Score = 42.7 bits (99), Expect = 3e-04 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +1 Query: 4 LPDPAKKLQVNAEESGDEVGDFPKLEEKLG 93 LPD +KL NAEES D+V D PK+EEK+G Sbjct: 19 LPDQGRKLHANAEESSDDVTDPPKVEEKIG 48
>ENPL_CATRO (P35016) Endoplasmin homolog precursor (GRP94 homolog)| Length = 817 Score = 32.7 bits (73), Expect = 0.29 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +1 Query: 19 KKLQVNAEESGDEVGDFPKLEEKLGAVP 102 +K+ NAE D D PK+E+K+GAVP Sbjct: 24 RKIHANAEADSDAPVDPPKVEDKIGAVP 51
>YW60_CAEEL (Q22634) Hypothetical protein T21C12.3| Length = 145 Score = 27.7 bits (60), Expect = 9.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 31 VNAEESGDEVGDFPKLEEKLGAVPMACP 114 + + S D+ DFP L +K G PM+ P Sbjct: 39 LTSSSSEDDTPDFPSLRDKRGVDPMSIP 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,493,668 Number of Sequences: 219361 Number of extensions: 244424 Number of successful extensions: 446 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 80,573,946 effective HSP length: 15 effective length of database: 77,283,531 effective search space used: 1854804744 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits)