| Clone Name | bastl20b06 |
|---|---|
| Clone Library Name | barley_pub |
>ABFA_STRLI (P53627) Alpha-N-arabinofuranosidase (EC 3.2.1.55) (Arabinosidase)| (ABF) (Alpha-L-AF) Length = 662 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 27 LSPARKSAPRSAPGEPFHGRSVSRDETQATAMRGPP 134 ++P R+S P SAPG P R R T+A A RG P Sbjct: 624 VTPWRRSPPGSAPGTPAPTR---RRRTRAGASRGAP 656
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 9 TRCPPFLSPARKSAPRSAPGEPFHGRSVSRDETQATAMRGPP 134 T PP L P P P EP H V TQA GPP Sbjct: 527 TPTPPALPPTPTPTPEKDPEEPAHAPPVQSAPTQA----GPP 564
>TMPSD_MOUSE (Q5U405) Transmembrane protease, serine 13 (EC 3.4.21.-) (Mosaic| serine protease) (Membrane-type mosaic serine protease) Length = 543 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +3 Query: 3 SATRCPPFLSPAR----KSAPRSAPGEPFHGRSVSRDETQATAMRGPP 134 S R PP SPAR ++ P+++P S +R QA+ R PP Sbjct: 10 SPARTPPQASPARTSPARAPPQASPARTPPQASPARTPPQASPARAPP 57
>PTPRS_HUMAN (Q13332) Receptor-type tyrosine-protein phosphatase S precursor (EC| 3.1.3.48) (R-PTP-S) (Protein-tyrosine phosphatase sigma) (R-PTP-sigma) Length = 1948 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 21 PFLSPARKSAPRSAPGEPFHGRSVSRDETQATAMRGPP 134 P P + + PG+P + R+ +R ET T PP Sbjct: 511 PLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP 548
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 30 SPARKSAPRSAPGEPFHGRSVSRDET 107 SP +S PRS P RS+SRD T Sbjct: 817 SPGSRSRPRSRPRSRSRSRSLSRDRT 842 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,685,207 Number of Sequences: 219361 Number of extensions: 437388 Number of successful extensions: 1644 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1638 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)