| Clone Name | bastl20b05 |
|---|---|
| Clone Library Name | barley_pub |
>YL022_YEAST (Q07953) Hypothetical UPF0023 protein YLR022c| Length = 250 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 274 IEDICKSPEEQLDEVLRELDIAINEASGLIGNWHQTTSKIYFVWQIESVISDI 432 ++D K E+ LDEVL+ + +N + GL+ N + K + ++ VI +I Sbjct: 36 VQDYRKGIEKDLDEVLQIHQVFMNVSKGLVAN-KEDLQKCFGTTNVDDVIEEI 87
>MAST2_HUMAN (Q6P0Q8) Microtubule-associated serine/threonine-protein kinase 2 (EC| 2.7.11.1) Length = 1798 Score = 30.0 bits (66), Expect = 3.9 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 5 LPHTDAAGPNPPSPTAAPRRNPSVL 79 L HT P+PP PTA+P+R+PS L Sbjct: 1346 LAHT----PSPPPPTASPQRSPSPL 1366
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 30.0 bits (66), Expect = 3.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +2 Query: 8 PHTDAAGPNPPS---PTAAPRRNPSVLP 82 PH P+PPS P + P+R+PS LP Sbjct: 465 PHAPLMPPSPPSQVLPASEPKRHPSTLP 492
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 30.0 bits (66), Expect = 3.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +2 Query: 8 PHTDAAGPNPPS---PTAAPRRNPSVLP 82 PH P+PPS P + P+R+PS LP Sbjct: 465 PHVPLMPPSPPSQVIPASEPKRHPSTLP 492
>RB_MOUSE (P13405) Retinoblastoma-associated protein (PP105) (RB)| Length = 921 Score = 30.0 bits (66), Expect = 3.9 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +1 Query: 139 FSPRALLNSISHLSALTSDGSTARPKPIQKYCQNVCDISSIVSPLIEDICKSPEEQLDEV 318 FSP ALL +A+ +GS P+ Q + + +IE +CK E +DEV Sbjct: 223 FSPPALLREPYKTAAIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEV 282
>FUMC_SULSO (P39461) Fumarate hydratase class II (EC 4.2.1.2) (Fumarase C)| Length = 438 Score = 29.3 bits (64), Expect = 6.6 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 7/74 (9%) Frame = +1 Query: 163 SISHLSALTSDGSTARPKPIQKYCQNVCDISSIVSPLI-----EDICKSPEE--QLDEVL 321 ++ +S L DG A + +++Y ++ + +IVSP+I +I K + + E L Sbjct: 352 ALEKMSRLVIDGMVANVEKMKRYAESSPSLITIVSPVIGYDKATEIGKKLNKGMSIREAL 411 Query: 322 RELDIAINEASGLI 363 REL + NE + ++ Sbjct: 412 RELGYSDNEINKIL 425
>GLPK_PYRFU (Q8TZI8) Glycerol kinase (EC 2.7.1.30) (ATP:glycerol| 3-phosphotransferase) (Glycerokinase) (GK) Length = 490 Score = 29.3 bits (64), Expect = 6.6 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +1 Query: 286 CKSPEEQLDEVLRELDIAINEASGLIGNWHQTTSKIYFVWQIESV 420 C+ E ++E+ RE I E +GL+ + + + SKI W +++V Sbjct: 103 CRRTAEMVEEIKREYSDVIKEKTGLVPDAYFSASKI--AWLLDNV 145
>TXND4_MOUSE (Q9D1Q6) Thioredoxin domain-containing protein 4 precursor| (Endoplasmic reticulum resident protein ERp44) Length = 406 Score = 28.9 bits (63), Expect = 8.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 232 CQNVCDISSIVSPLIEDICKSPEEQLDEVLRELDIAI 342 C + ++SI +P+ +I E +DE+L D+A+ Sbjct: 14 CSLLLLVTSIFTPITAEIASLDSENIDEILNNADVAL 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,574,150 Number of Sequences: 219361 Number of extensions: 1150645 Number of successful extensions: 3912 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3905 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)