| Clone Name | bastl18h03 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 112 bits (281), Expect = 3e-25 Identities = 56/109 (51%), Positives = 73/109 (66%), Gaps = 4/109 (3%) Frame = +2 Query: 116 IRDITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGS----HHHEFGSNTPR 283 IRDI AAEA++KEGD F+LIT RWWQ WI+YV QD ++GS H GS+T + Sbjct: 24 IRDIAIAAEANSKEGDTFYLITQRWWQEWIEYVNQDQPCNTNDGSSLSEHCDSPGSSTLK 83 Query: 284 RPGAIDNTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQXVWEKLHSW 430 +P IDN++L+ D + E E+ +TL EGRDY+LLPQ VW +L SW Sbjct: 84 KPSRIDNSDLIYDSSLEDPSNTSEIIETLQEGRDYVLLPQEVWNQLRSW 132
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 54.7 bits (130), Expect = 9e-08 Identities = 36/103 (34%), Positives = 49/103 (47%) Frame = +2 Query: 122 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 301 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 302 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQXVWEKLHSW 430 N+ LL D D Q L + L + DYILLP W KL SW Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLPTEGWNKLVSW 103
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 54.7 bits (130), Expect = 9e-08 Identities = 36/103 (34%), Positives = 49/103 (47%) Frame = +2 Query: 122 DITAAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 301 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 302 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLPQXVWEKLHSW 430 N+ LL D D Q L + L + DYILLP W KL SW Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLPTEGWNKLVSW 103
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 50.8 bits (120), Expect = 1e-06 Identities = 30/93 (32%), Positives = 46/93 (49%) Frame = +2 Query: 152 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 331 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 332 EVSDMQIELHDTLAEGRDYILLPQXVWEKLHSW 430 + L + L + DY+L+P W KL +W Sbjct: 81 QT------LKEHLIDELDYVLVPAEAWNKLLNW 107
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 50.8 bits (120), Expect = 1e-06 Identities = 30/93 (32%), Positives = 46/93 (49%) Frame = +2 Query: 152 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 331 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 332 EVSDMQIELHDTLAEGRDYILLPQXVWEKLHSW 430 + L + L + DY+L+P W KL +W Sbjct: 81 QT------LKEHLIDELDYVLVPTEAWNKLLNW 107
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 47.0 bits (110), Expect = 2e-05 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 3/100 (3%) Frame = +2 Query: 140 EAHAKEGDIFFLITNRWWQSWIDYVI---QDSAGVPSNGSHHHEFGSNTPRRPGAIDNTN 310 E + G+ +FL+ W++ W YV QDS+ P G I+N Sbjct: 50 ERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFP-----------------GCINNAT 92 Query: 311 LLDDMASEVSDMQIELHDTLAEGRDYILLPQXVWEKLHSW 430 L D ++ L + L EG DY+LLP W L SW Sbjct: 93 LFQD------EINWRLKEGLVEGEDYVLLPAAAWHYLVSW 126
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 40.0 bits (92), Expect = 0.002 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Frame = +2 Query: 278 PRRPGAIDNTNLLDDMASEVSDMQIE---LHDT--LAEGRDYILLPQXVWEKLHSW 430 P++PGAIDN L+ + + + +E L T L GRDY ++P+ VW L+ W Sbjct: 518 PQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHW 573 Score = 31.2 bits (69), Expect = 1.1 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 12/93 (12%) Frame = +2 Query: 158 GDIFFLITNRWWQSWIDYVIQD------------SAGVPSNGSHHHEFGSNTPRRPGAID 301 G +F+I+ +WWQ W +YV D + G S G+ H R ++ Sbjct: 393 GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLS 452 Query: 302 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 400 N ++ S+ E +T G Y P Sbjct: 453 YVNTTEEKFSDNISTASEASETAGSGFLYSATP 485
>Y1052_HAEIN (P45008) Putative HTH-type transcriptional regulator HI1052| Length = 298 Score = 31.6 bits (70), Expect = 0.85 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +2 Query: 146 HAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHH-----HEFGSNTP 280 H KEGD+FFL N+ + Y A +P+ SH H+ G TP Sbjct: 59 HLKEGDVFFLPQNQ--PHSMHYSANKRADIPTKKSHQGLFELHQIGRGTP 106
>APJ_RAT (Q9JHG3) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) (B78) (GPCR34) Length = 377 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 294 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLXQSGKSCI 425 ++T +CWM +HL L ++ W L V YC+ SC+ Sbjct: 252 VVTFALCWMPYHLVKTLYMLGNLLHWPCDFDSFLMNVFPYCTCISYVNSCL 302
>APJ_MOUSE (Q9WV08) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) (MSR) Length = 377 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 294 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLXQSGKSCI 425 ++T +CWM +HL L ++ W L V YC+ SC+ Sbjct: 252 VVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNSCL 302
>APJ_MACMU (O97666) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) Length = 380 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 294 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLXQSGKSCI 425 ++T +CWM +HL L ++ W L V YC+ SC+ Sbjct: 254 VVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYVNSCL 304
>APJ_HUMAN (P35414) Apelin receptor (G-protein coupled receptor APJ)| (Angiotensin receptor-like 1) (HG11) Length = 380 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 294 LLTIQICWMTWHLKSPTCRLSYMIPW-------LKAVIIYCSLXQSGKSCI 425 ++T +CWM +HL L ++ W L + YC+ SC+ Sbjct: 254 VVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCL 304
>E136_ARATH (Q93Z08) Putative glucan endo-1,3-beta-glucosidase 6 precursor (EC| 3.2.1.39) ((1->3)-beta-glucan endohydrolase) ((1->3)-beta-glucanase) (Beta-1,3-endoglucanase) (Beta-1,3-glucanase) Length = 477 Score = 28.1 bits (61), Expect = 9.4 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +2 Query: 254 HHEFGSNTPRRPGAIDN--TNLLDDMASEVSDMQIELH 361 H G TPRRPG ID +L+D+ A V E H Sbjct: 288 HISGGKGTPRRPGPIDAYLFSLIDEDAKSVQPGYFERH 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,858,418 Number of Sequences: 219361 Number of extensions: 842015 Number of successful extensions: 2373 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2361 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)